BLASTX nr result
ID: Cocculus23_contig00057119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057119 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003850304.1| hypothetical protein MYCGRDRAFT_45952, parti... 65 1e-08 gb|EME82113.1| hypothetical protein MYCFIDRAFT_77593 [Pseudocerc... 62 6e-08 gb|EMF11644.1| DNA-directed RNA polymerase I and III 14 KDA poly... 59 5e-07 gb|EME43533.1| hypothetical protein DOTSEDRAFT_63729 [Dothistrom... 59 7e-07 >ref|XP_003850304.1| hypothetical protein MYCGRDRAFT_45952, partial [Zymoseptoria tritici IPO323] gi|339470182|gb|EGP85280.1| hypothetical protein MYCGRDRAFT_45952 [Zymoseptoria tritici IPO323] Length = 101 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 300 VLRKGLEDLSDLCDVVEEKFTASRDEFNAAHPDRVS 193 VLRKGL+DLSD+CD VEEKFT +RDEFN A+PDRVS Sbjct: 64 VLRKGLDDLSDMCDAVEEKFTTARDEFNEANPDRVS 99 >gb|EME82113.1| hypothetical protein MYCFIDRAFT_77593 [Pseudocercospora fijiensis CIRAD86] Length = 133 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 300 VLRKGLEDLSDLCDVVEEKFTASRDEFNAAHPDR 199 VLRKGLEDL+DLCD VEEKFT +RDEFNAA+P+R Sbjct: 96 VLRKGLEDLADLCDAVEEKFTEARDEFNAANPER 129 >gb|EMF11644.1| DNA-directed RNA polymerase I and III 14 KDA polypeptide [Sphaerulina musiva SO2202] Length = 134 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 300 VLRKGLEDLSDLCDVVEEKFTASRDEFNAAHPD 202 VLRKGL+DL D+CDV+EEKF ASRDEF +HPD Sbjct: 96 VLRKGLQDLEDMCDVIEEKFVASRDEFKISHPD 128 >gb|EME43533.1| hypothetical protein DOTSEDRAFT_63729 [Dothistroma septosporum NZE10] Length = 133 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -1 Query: 300 VLRKGLEDLSDLCDVVEEKFTASRDEFNAAHPDRVSGK 187 VLR+ LE+L+DLCD VEEKF ASRD+FN HPDR+ + Sbjct: 96 VLRRALENLADLCDAVEEKFVASRDQFNEDHPDRIGSR 133