BLASTX nr result
ID: Cocculus23_contig00056992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056992 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON65269.1| TATA-box-binding protein [Coniosporium apollinis ... 71 1e-10 gb|EMF11507.1| transcription initiation factor TFIID, TATA bindi... 70 3e-10 gb|EAS32669.2| TATA-box-binding protein [Coccidioides immitis RS] 70 3e-10 ref|XP_001244115.1| hypothetical protein CIMG_03556 [Coccidioide... 70 3e-10 ref|XP_002582571.1| TATA-box binding protein [Uncinocarpus reesi... 70 4e-10 ref|XP_007588693.1| putative tata-box-binding protein [Neofusico... 68 1e-09 gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina... 68 2e-09 gb|EME88782.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocer... 67 2e-09 gb|EXJ67888.1| TATA-box-binding protein [Cladophialophora psammo... 67 3e-09 gb|EXJ57364.1| TATA-box-binding protein [Cladophialophora yegres... 67 3e-09 gb|ETI25600.1| TATA-box-binding protein [Cladophialophora carrio... 67 3e-09 gb|EHY53483.1| TATA-box-binding protein [Exophiala dermatitidis ... 67 3e-09 ref|XP_001271014.1| RNA polymerase I and III transcription facto... 66 4e-09 ref|XP_001543036.1| TATA-box binding protein [Ajellomyces capsul... 66 6e-09 gb|EXJ87732.1| TATA-box-binding protein [Capronia coronata CBS 6... 65 8e-09 gb|EXJ82893.1| TATA-box-binding protein [Capronia epimyces CBS 6... 65 8e-09 gb|EEH04879.1| transcription initiation factor TFIID-2 [Ajellomy... 65 1e-08 dbj|GAD94706.1| RNA polymerase I and III transcription factor co... 65 1e-08 gb|EQL37384.1| TATA-box-binding protein [Ajellomyces dermatitidi... 65 1e-08 ref|XP_002623509.1| transcription initiation factor TFIID-2 [Aje... 65 1e-08 >gb|EON65269.1| TATA-box-binding protein [Coniosporium apollinis CBS 100218] Length = 251 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +2 Query: 107 ETAYITHPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 + A I+HP+ AQQAK FTAP+SLSFPG AG LTPPSSEKD Q+NG Sbjct: 7 QPAIISHPANAQQAKAFTAPTSLSFPGGAGDLTPPSSEKDGQAQSNG 53 >gb|EMF11507.1| transcription initiation factor TFIID, TATA binding protein [Sphaerulina musiva SO2202] Length = 258 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = +2 Query: 113 AYITHPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNGRTN 256 AY+THPSTA +AK FTAPSSLSFPGA GHLTPPSS DA Q + TN Sbjct: 5 AYMTHPSTAAEAKQFTAPSSLSFPGANGHLTPPSS--DAGQTSKNGTN 50 >gb|EAS32669.2| TATA-box-binding protein [Coccidioides immitis RS] Length = 299 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNGRTNT 259 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD + +G+ N+ Sbjct: 52 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDQNGMNSGQANS 97 >ref|XP_001244115.1| hypothetical protein CIMG_03556 [Coccidioides immitis RS] Length = 127 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNGRTNT 259 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD + +G+ N+ Sbjct: 52 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDQNGMNSGQANS 97 >ref|XP_002582571.1| TATA-box binding protein [Uncinocarpus reesii 1704] gi|237908078|gb|EEP82479.1| TATA-box binding protein [Uncinocarpus reesii 1704] Length = 251 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNGR 250 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEK+ + TNG+ Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKEPNGMTNGQ 48 >ref|XP_007588693.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] gi|485916518|gb|EOD43847.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] Length = 250 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 +HPSTA QAK FTAP SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 SHPSTATQAKAFTAPGSLSFPGGAGDLTPPSSEKDVQQSQNG 47 >gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina MS6] Length = 250 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/42 (76%), Positives = 32/42 (76%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THPS A QAK FTAP SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPSNATQAKAFTAPGSLSFPGGAGDLTPPSSEKDVQQSQNG 47 >gb|EME88782.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocercospora fijiensis CIRAD86] Length = 260 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/52 (67%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 104 META-YITHPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNGRTN 256 META Y+THP+TA +AK F AP SLSFPGAAGHLTPPSS DA Q + +N Sbjct: 1 METAAYMTHPNTAAEAKQFAAPGSLSFPGAAGHLTPPSS--DAGQPSKNGSN 50 >gb|EXJ67888.1| TATA-box-binding protein [Cladophialophora psammophila CBS 110553] Length = 255 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >gb|EXJ57364.1| TATA-box-binding protein [Cladophialophora yegresii CBS 114405] Length = 265 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >gb|ETI25600.1| TATA-box-binding protein [Cladophialophora carrionii CBS 160.54] Length = 262 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >gb|EHY53483.1| TATA-box-binding protein [Exophiala dermatitidis NIH/UT8656] Length = 268 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >ref|XP_001271014.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus clavatus NRRL 1] gi|119399160|gb|EAW09588.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus clavatus NRRL 1] Length = 273 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 5/50 (10%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKD-----ASQQTNGRTN 256 THPSTAQQA+ FT+P+SLSFPG AG LTPPSSEK+ +SQ NG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSSEKEGIMAMSSQGVNGNVN 55 >ref|XP_001543036.1| TATA-box binding protein [Ajellomyces capsulatus NAm1] gi|150406677|gb|EDN02218.1| TATA-box binding protein [Ajellomyces capsulatus NAm1] Length = 268 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 5/50 (10%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKD-----ASQQTNGRTN 256 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD SQ +N + N Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDPGMMNGSQPSNYQLN 55 >gb|EXJ87732.1| TATA-box-binding protein [Capronia coronata CBS 617.96] Length = 263 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THP+TAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPATAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >gb|EXJ82893.1| TATA-box-binding protein [Capronia epimyces CBS 606.96] Length = 260 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDASQQTNG 247 THP+TAQQAK FT+P+SLSFPG AG LTPPSSEKD Q NG Sbjct: 6 THPATAQQAKAFTSPASLSFPGGAGDLTPPSSEKD-GQNLNG 46 >gb|EEH04879.1| transcription initiation factor TFIID-2 [Ajellomyces capsulatus G186AR] gi|240273705|gb|EER37225.1| TATA-binding protein [Ajellomyces capsulatus H143] gi|325087599|gb|EGC40909.1| transcription initiation factor TFIID-2 [Ajellomyces capsulatus H88] Length = 262 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKD 226 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEKD Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKD 40 >dbj|GAD94706.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Byssochlamys spectabilis No. 5] Length = 261 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKD---ASQQTNGRTN 256 THPSTAQQAK FT+P+SLSFPG AG LTPPSSEK+ A NG N Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKEGNLAHGSQNGSVN 53 >gb|EQL37384.1| TATA-box-binding protein [Ajellomyces dermatitidis ATCC 26199] gi|531986798|gb|EQL37385.1| TATA-box-binding protein, variant [Ajellomyces dermatitidis ATCC 26199] Length = 262 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 5/48 (10%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDAS-----QQTNGR 250 THPSTA+QAK FT+P+SLSFPG AG LTPPSSEK+ QQ NG+ Sbjct: 6 THPSTAEQAKAFTSPASLSFPGGAGDLTPPSSEKEPGPEHGLQQANGQ 53 >ref|XP_002623509.1| transcription initiation factor TFIID-2 [Ajellomyces dermatitidis SLH14081] gi|239588523|gb|EEQ71166.1| transcription initiation factor TFIID-2 [Ajellomyces dermatitidis SLH14081] gi|239606906|gb|EEQ83893.1| transcription initiation factor TFIID-2 [Ajellomyces dermatitidis ER-3] gi|327351372|gb|EGE80229.1| hypothetical protein BDDG_03170 [Ajellomyces dermatitidis ATCC 18188] Length = 262 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 5/48 (10%) Frame = +2 Query: 122 THPSTAQQAKDFTAPSSLSFPGAAGHLTPPSSEKDAS-----QQTNGR 250 THPSTA+QAK FT+P+SLSFPG AG LTPPSSEK+ QQ NG+ Sbjct: 6 THPSTAEQAKAFTSPASLSFPGGAGDLTPPSSEKEPGPVHGLQQANGQ 53