BLASTX nr result
ID: Cocculus23_contig00056860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056860 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON95796.1| putative short chain dehydrogenase reductase fami... 64 2e-08 gb|EMR70200.1| putative short chain dehydrogenase reductase fami... 60 2e-07 gb|EMC97527.1| hypothetical protein BAUCODRAFT_68069 [Baudoinia ... 59 7e-07 gb|ETS83288.1| hypothetical protein PFICI_05164 [Pestalotiopsis ... 57 2e-06 >gb|EON95796.1| putative short chain dehydrogenase reductase family protein [Togninia minima UCRPA7] Length = 295 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 265 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR 173 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR Sbjct: 265 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR 295 >gb|EMR70200.1| putative short chain dehydrogenase reductase family protein [Eutypa lata UCREL1] Length = 266 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 265 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR 173 GMTVLYLAKN+YVNGEIIAVDGGVLNV++GR Sbjct: 236 GMTVLYLAKNQYVNGEIIAVDGGVLNVLAGR 266 >gb|EMC97527.1| hypothetical protein BAUCODRAFT_68069 [Baudoinia compniacensis UAMH 10762] Length = 300 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 265 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR 173 GMTVLYLAK EYVNGEIIAVDGGVLNVV GR Sbjct: 270 GMTVLYLAKCEYVNGEIIAVDGGVLNVVGGR 300 >gb|ETS83288.1| hypothetical protein PFICI_05164 [Pestalotiopsis fici W106-1] Length = 297 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 265 GMTVLYLAKNEYVNGEIIAVDGGVLNVVSGR 173 GMT LYLA N YVNGEIIAVDGGVLNVV+GR Sbjct: 267 GMTALYLANNHYVNGEIIAVDGGVLNVVAGR 297