BLASTX nr result
ID: Cocculus23_contig00056450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056450 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containi... 95 1e-17 gb|EXC24885.1| hypothetical protein L484_013254 [Morus notabilis] 94 2e-17 ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Popu... 93 4e-17 ref|XP_004169636.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_006340666.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006466854.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006425612.1| hypothetical protein CICLE_v10025108mg [Citr... 91 2e-16 emb|CBI17453.3| unnamed protein product [Vitis vinifera] 91 2e-16 ref|XP_007046822.1| Pentatricopeptide repeat (PPR) superfamily p... 90 3e-16 ref|XP_006857535.1| hypothetical protein AMTR_s00061p00035580 [A... 90 4e-16 ref|XP_007203772.1| hypothetical protein PRUPE_ppa002597mg [Prun... 89 8e-16 emb|CAN84077.1| hypothetical protein VITISV_032319 [Vitis vinifera] 88 1e-15 ref|XP_003629742.1| Pentatricopeptide repeat-containing protein ... 87 2e-15 gb|EYU31178.1| hypothetical protein MIMGU_mgv1a027138mg [Mimulus... 86 4e-15 ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_004289114.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_007159438.1| hypothetical protein PHAVU_002G237800g [Phas... 84 2e-14 ref|XP_004233728.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 >ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Vitis vinifera] Length = 647 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I IVKNLRICEDCH+VMCGAS++ REI VRDNMRFHHF DG CSCG+FW Sbjct: 598 IRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGRCSCGNFW 647 >gb|EXC24885.1| hypothetical protein L484_013254 [Morus notabilis] Length = 615 Score = 94.0 bits (232), Expect = 2e-17 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRICEDCH VMCGAS++ REI +RDNMRFHHF DG CSCGDFW Sbjct: 566 IKIMKNLRICEDCHVVMCGASKITGREIIIRDNMRFHHFCDGKCSCGDFW 615 >ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa] gi|550338737|gb|ERP60953.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa] Length = 654 Score = 92.8 bits (229), Expect = 4e-17 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I IVKNLRICEDCH+V+CGAS++ REI VRD MRFHHFHDG CSCG+FW Sbjct: 605 IRIVKNLRICEDCHSVICGASQITGREIIVRDIMRFHHFHDGICSCGNFW 654 >ref|XP_004169636.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Cucumis sativus] Length = 650 Score = 91.3 bits (225), Expect = 1e-16 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KN+RICEDCH VMC AS + REI VRDNMRFHHFH+G CSCG+FW Sbjct: 601 IKIMKNIRICEDCHNVMCAASEITGREIIVRDNMRFHHFHNGTCSCGNFW 650 >ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Cucumis sativus] Length = 650 Score = 91.3 bits (225), Expect = 1e-16 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KN+RICEDCH VMC AS + REI VRDNMRFHHFH+G CSCG+FW Sbjct: 601 IKIMKNIRICEDCHNVMCAASEITGREIIVRDNMRFHHFHNGTCSCGNFW 650 >ref|XP_006340666.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Solanum tuberosum] Length = 654 Score = 90.9 bits (224), Expect = 2e-16 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRICEDCH+ MCGAS++ REI VRDN RFHHFH+G CSCG+FW Sbjct: 605 IRIMKNLRICEDCHSFMCGASQITGREIIVRDNKRFHHFHNGVCSCGNFW 654 >ref|XP_006466854.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X1 [Citrus sinensis] gi|568824952|ref|XP_006466855.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X2 [Citrus sinensis] gi|568824954|ref|XP_006466856.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X3 [Citrus sinensis] gi|568824956|ref|XP_006466857.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X4 [Citrus sinensis] Length = 653 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 + I+KNLRICEDCH MCGAS+V+ REI VRDNMRFHHF DG CSCG++W Sbjct: 604 VRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW 653 >ref|XP_006425612.1| hypothetical protein CICLE_v10025108mg [Citrus clementina] gi|557527602|gb|ESR38852.1| hypothetical protein CICLE_v10025108mg [Citrus clementina] Length = 653 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 + I+KNLRICEDCH MCGAS+V+ REI VRDNMRFHHF DG CSCG++W Sbjct: 604 VRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW 653 >emb|CBI17453.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDF 247 I IVKNLRICEDCH+VMCGAS++ REI VRDNMRFHHF DG CSCG+F Sbjct: 380 IRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGRCSCGNF 428 >ref|XP_007046822.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508699083|gb|EOX90979.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 658 Score = 90.1 bits (222), Expect = 3e-16 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -3 Query: 396 PIMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 PI I+KNLRICEDCH+ MCG S++ +R I VRDN+RFHHFH G CSCG+FW Sbjct: 608 PIRIMKNLRICEDCHSFMCGVSQITERVIIVRDNLRFHHFHAGKCSCGNFW 658 >ref|XP_006857535.1| hypothetical protein AMTR_s00061p00035580 [Amborella trichopoda] gi|548861631|gb|ERN19002.1| hypothetical protein AMTR_s00061p00035580 [Amborella trichopoda] Length = 629 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I IVKNLR+C+DCH +MC ASRV +REI VRDNMRFHHF GACSCG+FW Sbjct: 580 IRIVKNLRMCDDCHLLMCVASRVAEREIVVRDNMRFHHFKQGACSCGEFW 629 >ref|XP_007203772.1| hypothetical protein PRUPE_ppa002597mg [Prunus persica] gi|462399303|gb|EMJ04971.1| hypothetical protein PRUPE_ppa002597mg [Prunus persica] Length = 654 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KN+RICEDCH MCGAS+V REI VRDNMRFHHF +G CSCG+FW Sbjct: 605 IKIMKNIRICEDCHVFMCGASQVAGREIVVRDNMRFHHFSNGKCSCGNFW 654 >emb|CAN84077.1| hypothetical protein VITISV_032319 [Vitis vinifera] Length = 228 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCG 253 I IVKNLRICEDCH+VMCGAS++ REI VRDNMRFHHF DG CSCG Sbjct: 138 IRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGGCSCG 184 >ref|XP_003629742.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523764|gb|AET04218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRICEDCH VMCGAS++ R+I VRDNMRFHHF +GACSC +FW Sbjct: 567 IKIMKNLRICEDCHIVMCGASKLTGRKIIVRDNMRFHHFLNGACSCNNFW 616 >gb|EYU31178.1| hypothetical protein MIMGU_mgv1a027138mg [Mimulus guttatus] Length = 654 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I IVKNLRIC DCH MCG S + +R+I VRDNMRFHHF DGACSC +FW Sbjct: 605 IRIVKNLRICVDCHLFMCGVSEISRRKIIVRDNMRFHHFEDGACSCRNFW 654 >ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Glycine max] Length = 617 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRICEDCH VMCGAS+V R+I VRDN RFHHF +GACSC +FW Sbjct: 568 IKIMKNLRICEDCHIVMCGASKVTGRKIVVRDNTRFHHFLNGACSCSNFW 617 >ref|XP_004289114.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Fragaria vesca subsp. vesca] Length = 650 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KN+RICEDCH MCGAS+V R I VRDNMRFHHF +G C+CG+FW Sbjct: 601 IKIIKNIRICEDCHGFMCGASQVTGRHIIVRDNMRFHHFENGKCNCGNFW 650 >ref|XP_007159438.1| hypothetical protein PHAVU_002G237800g [Phaseolus vulgaris] gi|561032853|gb|ESW31432.1| hypothetical protein PHAVU_002G237800g [Phaseolus vulgaris] Length = 617 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRIC+DCH VMCGASR+ R+I VRDN RFHHF +GACSC +FW Sbjct: 568 IKIMKNLRICKDCHIVMCGASRLTGRKIVVRDNTRFHHFLNGACSCRNFW 617 >ref|XP_004233728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Solanum lycopersicum] Length = 651 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLRICEDCH+ M GAS++ REI VRDN RFHHF +G CSCG+FW Sbjct: 602 IKIMKNLRICEDCHSFMGGASQITGREIIVRDNKRFHHFRNGVCSCGNFW 651 >ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 747 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -3 Query: 393 IMIVKNLRICEDCHTVMCGASRVMKREISVRDNMRFHHFHDGACSCGDFW 244 I I+KNLR+C DCHTV+ S+VM REI VRD+ RFHHF DG CSCGDFW Sbjct: 698 IQIIKNLRVCADCHTVIKLISKVMNREIVVRDSKRFHHFKDGLCSCGDFW 747