BLASTX nr result
ID: Cocculus23_contig00056396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056396 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78969.1| hypothetical protein (mitochondrion) [Vicia faba]... 66 6e-09 gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] 59 7e-07 >gb|AGC78969.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803261|gb|AGC78996.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 103 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = -2 Query: 204 GCRPRWRWSWEPTYTYFPGACLAPTSKSRAGAEKEPAQPLQESFAW 67 GCRPR+ SWEP FPGACLAPTSK AGAE + QPLQESFAW Sbjct: 63 GCRPRF--SWEPD---FPGACLAPTSKKNAGAEPKRNQPLQESFAW 103 >gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] Length = 478 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 170 QPILTFLGLALPQHLNQGRAPKRNQPSLFKKA 75 +P TFLGLALPQHLN+ RAPKRNQPSLFKKA Sbjct: 310 EPTYTFLGLALPQHLNKRRAPKRNQPSLFKKA 341