BLASTX nr result
ID: Cocculus23_contig00056267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056267 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513130.1| PREDICTED: uncharacterized protein LOC101488... 62 1e-07 gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsi... 56 5e-06 ref|XP_006579916.1| PREDICTED: F-box-like/WD repeat-containing p... 56 6e-06 ref|XP_006579914.1| PREDICTED: F-box-like/WD repeat-containing p... 56 6e-06 >ref|XP_004513130.1| PREDICTED: uncharacterized protein LOC101488260 [Cicer arietinum] Length = 752 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%) Frame = -1 Query: 222 YTSSDSLFSVSNDTTS-MSLSDIWHRRLGHPSNTVLHQVVRMCNPKVSLNKTLDICSSFQ 46 Y S + V+ D+ MS+ + WHR+LGHP+N VL +V++ CN K S N +C + Q Sbjct: 398 YQLSSANSQVNKDSCIYMSVKENWHRKLGHPNNKVLEKVLKNCNVKTSSNDHFLLCEACQ 457 Query: 45 LGKSHKLPFPNFLS 4 GK H LPF + S Sbjct: 458 FGKLHLLPFTSSYS 471 >gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1402 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -1 Query: 210 DSLFSVSNDTTSMSLSD-IWHRRLGHPSNTVLHQVVRMCNPKVSLNKT-LDICSSFQLGK 37 DS F T S SD +WHRRLGHP VL Q+V+ +S+NKT +C + QLGK Sbjct: 448 DSQFKAFFSTRQQSASDEVWHRRLGHPHPQVLQQLVK--TNSISINKTSKSLCEACQLGK 505 Query: 36 SHKLPF 19 S +LPF Sbjct: 506 STRLPF 511 >ref|XP_006579916.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1XR1-A-like isoform X3 [Glycine max] Length = 553 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = -1 Query: 219 TSSDSLFSVSN-----DTTSMSLSDIWHRRLGHPSNTVLHQVVRMCNPKVSLNKTL-DIC 58 TS+ ++ + SN D TS S +++WH RLGHP+ ++ V++ CN LNK + + C Sbjct: 432 TSAATINNTSNIVSNSDVTSSSSANLWHARLGHPNGHLMKIVLKQCNIS-QLNKNITEFC 490 Query: 57 SSFQLGKSHKLP 22 SS +GKSH+LP Sbjct: 491 SSCCMGKSHRLP 502 >ref|XP_006579914.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1XR1-A-like isoform X1 [Glycine max] Length = 649 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = -1 Query: 219 TSSDSLFSVSN-----DTTSMSLSDIWHRRLGHPSNTVLHQVVRMCNPKVSLNKTL-DIC 58 TS+ ++ + SN D TS S +++WH RLGHP+ ++ V++ CN LNK + + C Sbjct: 528 TSAATINNTSNIVSNSDVTSSSSANLWHARLGHPNGHLMKIVLKQCNIS-QLNKNITEFC 586 Query: 57 SSFQLGKSHKLP 22 SS +GKSH+LP Sbjct: 587 SSCCMGKSHRLP 598