BLASTX nr result
ID: Cocculus23_contig00056092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056092 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME82309.1| hypothetical protein MYCFIDRAFT_183074 [Pseudocer... 62 8e-08 gb|EMF11966.1| 60S ribosomal protein L28 [Sphaerulina musiva SO2... 60 3e-07 gb|EME43047.1| hypothetical protein DOTSEDRAFT_35388 [Dothistrom... 60 3e-07 >gb|EME82309.1| hypothetical protein MYCFIDRAFT_183074 [Pseudocercospora fijiensis CIRAD86] Length = 153 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = -1 Query: 346 TSSFSASTPSRKLYKSIVNSTAKKGYRSDLXXXXXXXXXXXXXXXXENKKEHERKP 179 TSSF +STPSRKLYKSIVNSTAKKGYR DL +NKKE + KP Sbjct: 86 TSSFKSSTPSRKLYKSIVNSTAKKGYRPDLRAEAVQRASAIKQSQRDNKKESKSKP 141 >gb|EMF11966.1| 60S ribosomal protein L28 [Sphaerulina musiva SO2202] Length = 162 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/57 (57%), Positives = 35/57 (61%) Frame = -1 Query: 349 QTSSFSASTPSRKLYKSIVNSTAKKGYRSDLXXXXXXXXXXXXXXXXENKKEHERKP 179 QT+SFSASTPSRKLY SIVNSTAKKGYR DL +NKK KP Sbjct: 88 QTASFSASTPSRKLYTSIVNSTAKKGYRPDLRAEAVARASAIKSSQRDNKKTRVSKP 144 >gb|EME43047.1| hypothetical protein DOTSEDRAFT_35388 [Dothistroma septosporum NZE10] Length = 153 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 349 QTSSFSASTPSRKLYKSIVNSTAKKGYRSDL 257 QTSSF+ASTP+RKLYKS+VNSTAKKGYRSDL Sbjct: 85 QTSSFNASTPTRKLYKSVVNSTAKKGYRSDL 115