BLASTX nr result
ID: Cocculus23_contig00056062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00056062 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_754608.1| RNA polymerase I and III transcription factor c... 80 2e-13 dbj|GAA84983.1| TATA-box binding protein [Aspergillus kawachii I... 80 2e-13 ref|XP_001397705.2| TATA-box-binding protein [Aspergillus niger ... 80 2e-13 emb|CAK46825.1| unnamed protein product [Aspergillus niger] gi|3... 80 2e-13 ref|XP_001263447.1| RNA polymerase I and III transcription facto... 80 2e-13 ref|XP_001271014.1| RNA polymerase I and III transcription facto... 80 2e-13 dbj|GAD94706.1| RNA polymerase I and III transcription factor co... 80 4e-13 ref|XP_001213720.1| TATA-box binding protein [Aspergillus terreu... 80 4e-13 gb|EHY53483.1| TATA-box-binding protein [Exophiala dermatitidis ... 79 5e-13 gb|EXJ82893.1| TATA-box-binding protein [Capronia epimyces CBS 6... 79 9e-13 gb|EXJ67888.1| TATA-box-binding protein [Cladophialophora psammo... 78 1e-12 ref|XP_001819715.1| TATA-box-binding protein [Aspergillus oryzae... 78 1e-12 gb|EXJ57364.1| TATA-box-binding protein [Cladophialophora yegres... 75 7e-12 gb|ETI25600.1| TATA-box-binding protein [Cladophialophora carrio... 75 7e-12 gb|EXJ87732.1| TATA-box-binding protein [Capronia coronata CBS 6... 74 2e-11 ref|XP_002582571.1| TATA-box binding protein [Uncinocarpus reesi... 74 2e-11 gb|EKV05837.1| RNA polymerase I and III transcription factor com... 73 4e-11 ref|XP_002143637.1| RNA polymerase I and III transcription facto... 73 4e-11 gb|ERF69410.1| TATA-box-binding protein [Endocarpon pusillum Z07... 73 5e-11 gb|EAS32669.2| TATA-box-binding protein [Coccidioides immitis RS] 73 5e-11 >ref|XP_754608.1| RNA polymerase I and III transcription factor complex component Tbp [Aspergillus fumigatus Af293] gi|66852245|gb|EAL92570.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus fumigatus Af293] gi|159127621|gb|EDP52736.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus fumigatus A1163] Length = 283 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/57 (70%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDG-LSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPPSSEK+G ++ A G NG NG QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSSEKEGNITIGAQGANGTVNGHQQGGN 62 >dbj|GAA84983.1| TATA-box binding protein [Aspergillus kawachii IFO 4308] Length = 262 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/56 (71%), Positives = 43/56 (76%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPP S+KDG A G NG NGQ QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPP-SDKDGNMAMAQGANGMMNGQQQGGN 60 >ref|XP_001397705.2| TATA-box-binding protein [Aspergillus niger CBS 513.88] Length = 262 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/56 (71%), Positives = 43/56 (76%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPP S+KDG A G NG NGQ QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPP-SDKDGNMAMAQGANGMMNGQQQGGN 60 >emb|CAK46825.1| unnamed protein product [Aspergillus niger] gi|350633630|gb|EHA21995.1| hypothetical protein ASPNIDRAFT_210581 [Aspergillus niger ATCC 1015] Length = 282 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/56 (71%), Positives = 43/56 (76%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPP S+KDG A G NG NGQ QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPP-SDKDGNMAMAQGANGMMNGQQQGGN 60 >ref|XP_001263447.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Neosartorya fischeri NRRL 181] gi|119411607|gb|EAW21550.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Neosartorya fischeri NRRL 181] Length = 264 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/57 (70%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDG-LSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPPSSEK+G ++ A G NG NG QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSSEKEGNMAIGAQGANGTVNGHQQGGN 62 >ref|XP_001271014.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus clavatus NRRL 1] gi|119399160|gb|EAW09588.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Aspergillus clavatus NRRL 1] Length = 273 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDG-LSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPPSSEK+G ++ + G NG NG QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSSEKEGIMAMSSQGVNGNVNGHQQGAN 62 >dbj|GAD94706.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Byssochlamys spectabilis No. 5] Length = 261 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/56 (71%), Positives = 44/56 (78%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEK+G + +NG NGQ QG N Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKEG-NLAHGSQNGSVNGQQQGGN 60 >ref|XP_001213720.1| TATA-box binding protein [Aspergillus terreus NIH2624] gi|114193289|gb|EAU34989.1| TATA-box binding protein [Aspergillus terreus NIH2624] Length = 263 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPPS + ++ A G NG NGQ QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSDKDPNMAMNAQGANGNVNGQQQGGN 61 >gb|EHY53483.1| TATA-box-binding protein [Exophiala dermatitidis NIH/UT8656] Length = 268 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/59 (72%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANG---RNGFANGQSQGQN 271 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEKDG Q NG +G NGQ QG N Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDG--QNLNGGSYADGKMNGQPQGGN 62 >gb|EXJ82893.1| TATA-box-binding protein [Capronia epimyces CBS 606.96] Length = 260 Score = 78.6 bits (192), Expect = 9e-13 Identities = 42/59 (71%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANG---RNGFANGQSQGQN 271 THP+TAQQAK FT+PASLSFPGGAG LTPPSSEKDG Q NG +G NGQ QG N Sbjct: 6 THPATAQQAKAFTSPASLSFPGGAGDLTPPSSEKDG--QNLNGSSYADGKMNGQQQGGN 62 >gb|EXJ67888.1| TATA-box-binding protein [Cladophialophora psammophila CBS 110553] Length = 255 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQ 268 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEKDG Q NG +A+G++ GQ Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDG--QNLNG-GSYADGKTNGQ 57 >ref|XP_001819715.1| TATA-box-binding protein [Aspergillus oryzae RIB40] gi|238487092|ref|XP_002374784.1| transcription factor TFIID [Aspergillus flavus NRRL3357] gi|83767574|dbj|BAE57713.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699663|gb|EED56002.1| transcription factor TFIID [Aspergillus flavus NRRL3357] gi|391867294|gb|EIT76540.1| TATA-box binding protein (TBP), component of TFIID and TFIIIB [Aspergillus oryzae 3.042] Length = 263 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPSTAQQA+ FT+PASLSFPGGAG LTPPS + ++ G NG NGQ QG N Sbjct: 6 THPSTAQQARAFTSPASLSFPGGAGDLTPPSDKDGNMAMNLQGVNGHVNGQQQGGN 61 >gb|EXJ57364.1| TATA-box-binding protein [Cladophialophora yegresii CBS 114405] Length = 265 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQ 268 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEKDG + GQ QGQ Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDGQNLNGGSYADGKMGQPQGQ 60 >gb|ETI25600.1| TATA-box-binding protein [Cladophialophora carrionii CBS 160.54] Length = 262 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQ 268 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEKDG + GQ QGQ Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDGQNLNGGSYADGKMGQPQGQ 60 >gb|EXJ87732.1| TATA-box-binding protein [Capronia coronata CBS 617.96] Length = 263 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQG 265 THP+TAQQAK FT+PASLSFPGGAG LTPPSSEKDG Q NG +A+G+ G Sbjct: 6 THPATAQQAKAFTSPASLSFPGGAGDLTPPSSEKDG--QNLNG-GSYADGKMNG 56 >ref|XP_002582571.1| TATA-box binding protein [Uncinocarpus reesii 1704] gi|237908078|gb|EEP82479.1| TATA-box binding protein [Uncinocarpus reesii 1704] Length = 251 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/55 (69%), Positives = 41/55 (74%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQ 268 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEK+ NG NGQ+ GQ Sbjct: 6 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKE--------PNGMTNGQAGGQ 52 >gb|EKV05837.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum PHI26] gi|425780061|gb|EKV18083.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum Pd1] Length = 263 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQGQN 271 THPS AQQA+ FTA +SLSFPGGAG LTPP+SEK+ ++Q NG N NGQ G N Sbjct: 6 THPSNAQQARAFTATSSLSFPGGAGDLTPPNSEKEAMAQGGNGMN---NGQQAGGN 58 >ref|XP_002143637.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526962|ref|XP_002143638.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526964|ref|XP_002143639.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|62956011|gb|AAY23352.1| TATA-binding protein [Talaromyces marneffei] gi|62956013|gb|AAY23353.1| TATA-binding protein [Talaromyces marneffei] gi|210073035|gb|EEA27122.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073036|gb|EEA27123.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073037|gb|EEA27124.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] Length = 255 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLSQQANGRNGFANGQSQG 265 THPS AQQAK FT+PASLSFPGGAG LTPPSSEK+G NG+ AN G Sbjct: 6 THPSNAQQAKAFTSPASLSFPGGAGDLTPPSSEKEGNLAGLNGQQQGANANGNG 59 >gb|ERF69410.1| TATA-box-binding protein [Endocarpon pusillum Z07020] Length = 273 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/55 (65%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKDGLS-QQANGRNGFANGQSQG 265 THP+ A+QA+ FTAP+SLSFPGGAG LTPPSSEKDGL +G N NGQ G Sbjct: 14 THPANAEQARAFTAPSSLSFPGGAGDLTPPSSEKDGLHLGGGSGANAHMNGQQPG 68 >gb|EAS32669.2| TATA-box-binding protein [Coccidioides immitis RS] Length = 299 Score = 72.8 bits (177), Expect = 5e-11 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 3/53 (5%) Frame = +2 Query: 104 THPSTAQQAKDFTAPASLSFPGGAGHLTPPSSEKD--GL-SQQANGRNGFANG 253 THPSTAQQAK FT+PASLSFPGGAG LTPPSSEKD G+ S QAN + G ANG Sbjct: 52 THPSTAQQAKAFTSPASLSFPGGAGDLTPPSSEKDQNGMNSGQANSQQG-ANG 103