BLASTX nr result
ID: Cocculus23_contig00055905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055905 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21785.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002267587.1| PREDICTED: uncharacterized protein LOC100261... 64 2e-08 ref|XP_006346043.1| PREDICTED: uncharacterized protein LOC102581... 64 3e-08 ref|XP_006346042.1| PREDICTED: uncharacterized protein LOC102581... 64 3e-08 ref|XP_004243980.1| PREDICTED: uncharacterized protein LOC101257... 64 3e-08 ref|XP_004243979.1| PREDICTED: uncharacterized protein LOC101257... 64 3e-08 ref|XP_006855629.1| hypothetical protein AMTR_s00044p00093570 [A... 63 4e-08 ref|XP_006280203.1| hypothetical protein CARUB_v10026108mg [Caps... 63 4e-08 ref|XP_006441047.1| hypothetical protein CICLE_v10019372mg [Citr... 62 6e-08 ref|XP_006441046.1| hypothetical protein CICLE_v10019372mg [Citr... 62 6e-08 ref|XP_002317619.1| hypothetical protein POPTR_0011s14640g [Popu... 62 8e-08 ref|XP_007022258.1| Trypsin family protein [Theobroma cacao] gi|... 62 1e-07 ref|XP_007024934.1| Trypsin family protein isoform 4, partial [T... 61 1e-07 ref|XP_007024931.1| Trypsin family protein isoform 1 [Theobroma ... 61 1e-07 gb|EXC59450.1| hypothetical protein L484_000742 [Morus notabilis] 61 2e-07 ref|XP_006398149.1| hypothetical protein EUTSA_v10000823mg [Eutr... 61 2e-07 ref|XP_006843776.1| hypothetical protein AMTR_s00007p00244990 [A... 61 2e-07 ref|XP_002865302.1| hypothetical protein ARALYDRAFT_917056 [Arab... 61 2e-07 ref|XP_002863529.1| hypothetical protein ARALYDRAFT_917030 [Arab... 61 2e-07 ref|XP_002513414.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 >emb|CBI21785.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF DDFDM+ +TTLVKGVGEIG Sbjct: 188 ETFVRADGAFIPFADDFDMSTITTLVKGVGEIG 220 >ref|XP_002267587.1| PREDICTED: uncharacterized protein LOC100261226 [Vitis vinifera] Length = 603 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF DDFDM+ +TTLVKGVGEIG Sbjct: 294 ETFVRADGAFIPFADDFDMSTITTLVKGVGEIG 326 >ref|XP_006346043.1| PREDICTED: uncharacterized protein LOC102581957 isoform X2 [Solanum tuberosum] Length = 599 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPFTDDFDM VTT VKG+GEIG Sbjct: 292 ETFVRADGAFIPFTDDFDMTSVTTSVKGIGEIG 324 >ref|XP_006346042.1| PREDICTED: uncharacterized protein LOC102581957 isoform X1 [Solanum tuberosum] Length = 603 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPFTDDFDM VTT VKG+GEIG Sbjct: 296 ETFVRADGAFIPFTDDFDMTSVTTSVKGIGEIG 328 >ref|XP_004243980.1| PREDICTED: uncharacterized protein LOC101257191 isoform 2 [Solanum lycopersicum] Length = 599 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPFTDDFDM VTT VKG+GEIG Sbjct: 292 ETFVRADGAFIPFTDDFDMTSVTTSVKGIGEIG 324 >ref|XP_004243979.1| PREDICTED: uncharacterized protein LOC101257191 isoform 1 [Solanum lycopersicum] Length = 603 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPFTDDFDM VTT VKG+GEIG Sbjct: 296 ETFVRADGAFIPFTDDFDMTSVTTSVKGIGEIG 328 >ref|XP_006855629.1| hypothetical protein AMTR_s00044p00093570 [Amborella trichopoda] gi|548859416|gb|ERN17096.1| hypothetical protein AMTR_s00044p00093570 [Amborella trichopoda] Length = 552 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DFDM+KVTTLVKGVG IG Sbjct: 284 ETFVRADGAFIPFAEDFDMSKVTTLVKGVGRIG 316 >ref|XP_006280203.1| hypothetical protein CARUB_v10026108mg [Capsella rubella] gi|482548907|gb|EOA13101.1| hypothetical protein CARUB_v10026108mg [Capsella rubella] Length = 605 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DFDMN VTT VKGVGEIG Sbjct: 294 ETFVRADGAFIPFAEDFDMNNVTTTVKGVGEIG 326 >ref|XP_006441047.1| hypothetical protein CICLE_v10019372mg [Citrus clementina] gi|568848484|ref|XP_006478038.1| PREDICTED: uncharacterized protein LOC102612774 [Citrus sinensis] gi|557543309|gb|ESR54287.1| hypothetical protein CICLE_v10019372mg [Citrus clementina] Length = 604 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 102 AETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 AETFVRADGAFIPF DDFDM+ VTT VKG+GEIG Sbjct: 293 AETFVRADGAFIPFADDFDMSTVTTSVKGLGEIG 326 >ref|XP_006441046.1| hypothetical protein CICLE_v10019372mg [Citrus clementina] gi|557543308|gb|ESR54286.1| hypothetical protein CICLE_v10019372mg [Citrus clementina] Length = 457 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 102 AETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 AETFVRADGAFIPF DDFDM+ VTT VKG+GEIG Sbjct: 146 AETFVRADGAFIPFADDFDMSTVTTSVKGLGEIG 179 >ref|XP_002317619.1| hypothetical protein POPTR_0011s14640g [Populus trichocarpa] gi|222860684|gb|EEE98231.1| hypothetical protein POPTR_0011s14640g [Populus trichocarpa] Length = 597 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPFTDDFDM+ V T VKGVGEIG Sbjct: 292 ETFVRADGAFIPFTDDFDMSTVNTSVKGVGEIG 324 >ref|XP_007022258.1| Trypsin family protein [Theobroma cacao] gi|508721886|gb|EOY13783.1| Trypsin family protein [Theobroma cacao] Length = 603 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEI 4 ETFVRADGAFIPFTDDFDM+ VTT VKGVGEI Sbjct: 294 ETFVRADGAFIPFTDDFDMSTVTTSVKGVGEI 325 >ref|XP_007024934.1| Trypsin family protein isoform 4, partial [Theobroma cacao] gi|508780300|gb|EOY27556.1| Trypsin family protein isoform 4, partial [Theobroma cacao] Length = 517 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DF+MN VTT VKGVGEIG Sbjct: 294 ETFVRADGAFIPFAEDFNMNNVTTTVKGVGEIG 326 >ref|XP_007024931.1| Trypsin family protein isoform 1 [Theobroma cacao] gi|590622019|ref|XP_007024932.1| Trypsin family protein isoform 1 [Theobroma cacao] gi|590622023|ref|XP_007024933.1| Trypsin family protein isoform 1 [Theobroma cacao] gi|508780297|gb|EOY27553.1| Trypsin family protein isoform 1 [Theobroma cacao] gi|508780298|gb|EOY27554.1| Trypsin family protein isoform 1 [Theobroma cacao] gi|508780299|gb|EOY27555.1| Trypsin family protein isoform 1 [Theobroma cacao] Length = 607 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DF+MN VTT VKGVGEIG Sbjct: 294 ETFVRADGAFIPFAEDFNMNNVTTTVKGVGEIG 326 >gb|EXC59450.1| hypothetical protein L484_000742 [Morus notabilis] Length = 604 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF DDFDM+ VTT V+GVGEIG Sbjct: 292 ETFVRADGAFIPFADDFDMSTVTTSVRGVGEIG 324 >ref|XP_006398149.1| hypothetical protein EUTSA_v10000823mg [Eutrema salsugineum] gi|557099238|gb|ESQ39602.1| hypothetical protein EUTSA_v10000823mg [Eutrema salsugineum] Length = 605 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DF+MN VTT VKG+GEIG Sbjct: 294 ETFVRADGAFIPFAEDFNMNNVTTTVKGIGEIG 326 >ref|XP_006843776.1| hypothetical protein AMTR_s00007p00244990 [Amborella trichopoda] gi|548846144|gb|ERN05451.1| hypothetical protein AMTR_s00007p00244990 [Amborella trichopoda] Length = 499 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAF+PF D FDM+KVTT+VKGVG++G Sbjct: 326 ETFVRADGAFVPFADSFDMSKVTTIVKGVGDMG 358 >ref|XP_002865302.1| hypothetical protein ARALYDRAFT_917056 [Arabidopsis lyrata subsp. lyrata] gi|297311137|gb|EFH41561.1| hypothetical protein ARALYDRAFT_917056 [Arabidopsis lyrata subsp. lyrata] Length = 614 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DF+MN VTT VKG+GEIG Sbjct: 297 ETFVRADGAFIPFAEDFNMNNVTTTVKGIGEIG 329 >ref|XP_002863529.1| hypothetical protein ARALYDRAFT_917030 [Arabidopsis lyrata subsp. lyrata] gi|297309364|gb|EFH39788.1| hypothetical protein ARALYDRAFT_917030 [Arabidopsis lyrata subsp. lyrata] Length = 578 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF +DF+MN VTT VKG+GEIG Sbjct: 261 ETFVRADGAFIPFAEDFNMNNVTTTVKGIGEIG 293 >ref|XP_002513414.1| conserved hypothetical protein [Ricinus communis] gi|223547322|gb|EEF48817.1| conserved hypothetical protein [Ricinus communis] Length = 600 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 ETFVRADGAFIPFTDDFDMNKVTTLVKGVGEIG 1 ETFVRADGAFIPF DDFDM+ VTT VKGVG+IG Sbjct: 293 ETFVRADGAFIPFADDFDMSTVTTSVKGVGQIG 325