BLASTX nr result
ID: Cocculus23_contig00055747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055747 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99152.1| hypothetical protein BAUCODRAFT_31468 [Baudoinia ... 82 8e-14 ref|XP_003856132.1| 60S ribosomal protein L20, partial [Zymosept... 80 2e-13 gb|EME46101.1| hypothetical protein DOTSEDRAFT_70186 [Dothistrom... 80 4e-13 gb|EMF14474.1| 60S ribosomal protein L20 [Sphaerulina musiva SO2... 77 3e-12 ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres... 70 2e-10 ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora triti... 70 2e-10 gb|EME82975.1| hypothetical protein MYCFIDRAFT_51495 [Pseudocerc... 69 5e-10 gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris ... 69 7e-10 gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris z... 69 7e-10 gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolari... 69 7e-10 gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris... 69 7e-10 ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunne... 69 7e-10 gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaer... 69 9e-10 ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Lepto... 68 2e-09 ref|XP_003071410.1| 60S ribosomal protein L20 [Coccidioides posa... 68 2e-09 ref|XP_001245490.1| 60S ribosomal protein L20 [Coccidioides immi... 68 2e-09 gb|EEH11334.1| 60S ribosomal protein L20 [Ajellomyces capsulatus... 67 2e-09 ref|XP_001541495.1| 60S ribosomal protein L20 [Ajellomyces capsu... 67 2e-09 ref|XP_001801850.1| hypothetical protein SNOG_11611 [Phaeosphaer... 67 3e-09 gb|EEQ86274.1| 60S ribosomal protein L18A [Ajellomyces dermatiti... 66 4e-09 >gb|EMC99152.1| hypothetical protein BAUCODRAFT_31468 [Baudoinia compniacensis UAMH 10762] Length = 148 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLL+KDLKFPLPHRVPPK GKK+FAATRPNTFY Sbjct: 110 RRPYIKQLLSKDLKFPLPHRVPPKKGKKVFAATRPNTFY 148 >ref|XP_003856132.1| 60S ribosomal protein L20, partial [Zymoseptoria tritici IPO323] gi|339476017|gb|EGP91108.1| hypothetical protein MYCGRDRAFT_34437 [Zymoseptoria tritici IPO323] Length = 173 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTKDLKFPLPHR PPK GK+IFAATRPNTFY Sbjct: 135 RRPYIKQLLTKDLKFPLPHRAPPKHGKQIFAATRPNTFY 173 >gb|EME46101.1| hypothetical protein DOTSEDRAFT_70186 [Dothistroma septosporum NZE10] Length = 148 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQL TKDLKFPLPHR PPK GKK+FAATRPNTFY Sbjct: 110 RRPYIKQLTTKDLKFPLPHRAPPKRGKKVFAATRPNTFY 148 >gb|EMF14474.1| 60S ribosomal protein L20 [Sphaerulina musiva SO2202] Length = 204 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQL TK+LKFPLPHR PKSGKK+FAATRPNTFY Sbjct: 166 RRPYIKQLTTKNLKFPLPHRAAPKSGKKVFAATRPNTFY 204 >ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres f. teres 0-1] gi|311330357|gb|EFQ94776.1| hypothetical protein PTT_07431 [Pyrenophora teres f. teres 0-1] Length = 175 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+F+ATRP+TF+ Sbjct: 137 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 175 >ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981093|gb|EDU47719.1| 60S ribosomal protein L18ae [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 174 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+F+ATRP+TF+ Sbjct: 136 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 174 >gb|EME82975.1| hypothetical protein MYCFIDRAFT_51495 [Pseudocercospora fijiensis CIRAD86] Length = 175 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQL +K+LKFP+PHR PP S K +FAATRPNTFY Sbjct: 137 RRPYIKQLTSKNLKFPMPHRAPPTSKKVVFAATRPNTFY 175 >gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris oryzae ATCC 44560] Length = 190 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+FAA RP+TF+ Sbjct: 152 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13] gi|578485853|gb|EUN23340.1| hypothetical protein COCVIDRAFT_29773 [Bipolaris victoriae FI3] Length = 191 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+FAA RP+TF+ Sbjct: 153 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 191 >gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolaris maydis C5] gi|477586910|gb|ENI03993.1| hypothetical protein COCC4DRAFT_198673 [Bipolaris maydis ATCC 48331] Length = 205 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+FAA RP+TF+ Sbjct: 167 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 205 >gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris sorokiniana ND90Pr] Length = 190 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+FAA RP+TF+ Sbjct: 152 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859021|gb|EKD12094.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 242 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 +RPYIKQLLTKDLKFPLPHRV +GKKIF+ +RP+TFY Sbjct: 204 KRPYIKQLLTKDLKFPLPHRVSKSTGKKIFSGSRPSTFY 242 >gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaeria turcica Et28A] Length = 173 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLLTK+LKFPLPHR+ K+GKK+F+A RP+TF+ Sbjct: 135 RRPYIKQLLTKNLKFPLPHRINKKAGKKVFSANRPSTFF 173 >ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] gi|312217984|emb|CBX97931.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] Length = 182 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLL K+LKFPLPHR+ K+GKKIF++TRP+TF+ Sbjct: 144 RRPYIKQLLVKNLKFPLPHRINKKAGKKIFSSTRPSTFF 182 >ref|XP_003071410.1| 60S ribosomal protein L20 [Coccidioides posadasii C735 delta SOWgp] gi|240111112|gb|EER29265.1| 60S ribosomal protein L20, putative [Coccidioides posadasii C735 delta SOWgp] Length = 148 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTF 114 RRPYIKQLLTKDLKFPLPHRV GK++FAA+RP+TF Sbjct: 110 RRPYIKQLLTKDLKFPLPHRVSKPQGKRVFAASRPSTF 147 >ref|XP_001245490.1| 60S ribosomal protein L20 [Coccidioides immitis RS] gi|320032825|gb|EFW14775.1| 60S ribosomal protein L18A [Coccidioides posadasii str. Silveira] gi|392868384|gb|EAS34164.2| 60S ribosomal protein L20 [Coccidioides immitis RS] Length = 174 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTF 114 RRPYIKQLLTKDLKFPLPHRV GK++FAA+RP+TF Sbjct: 136 RRPYIKQLLTKDLKFPLPHRVSKPQGKRVFAASRPSTF 173 >gb|EEH11334.1| 60S ribosomal protein L20 [Ajellomyces capsulatus G186AR] Length = 231 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTF 114 RRPYIKQL+TK+LKFPLPHRVP S KKIFAA RP+TF Sbjct: 193 RRPYIKQLITKNLKFPLPHRVPKASTKKIFAAQRPSTF 230 >ref|XP_001541495.1| 60S ribosomal protein L20 [Ajellomyces capsulatus NAm1] gi|150411674|gb|EDN07062.1| 60S ribosomal protein L18A [Ajellomyces capsulatus NAm1] gi|240279872|gb|EER43377.1| ribosomal L18ae protein family [Ajellomyces capsulatus H143] gi|325093003|gb|EGC46313.1| ribosomal L18ae protein family [Ajellomyces capsulatus H88] Length = 174 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTF 114 RRPYIKQL+TK+LKFPLPHRVP S KKIFAA RP+TF Sbjct: 136 RRPYIKQLITKNLKFPLPHRVPKASTKKIFAAQRPSTF 173 >ref|XP_001801850.1| hypothetical protein SNOG_11611 [Phaeosphaeria nodorum SN15] gi|160703278|gb|EAT81319.2| hypothetical protein SNOG_11611 [Phaeosphaeria nodorum SN15] Length = 174 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTFY 117 RRPYIKQLL K LKFPLPHR+ K+GKK+FAA RP+TF+ Sbjct: 136 RRPYIKQLLVKGLKFPLPHRINKKAGKKVFAAKRPSTFF 174 >gb|EEQ86274.1| 60S ribosomal protein L18A [Ajellomyces dermatitidis ER-3] gi|327357313|gb|EGE86170.1| 60S ribosomal protein L20 [Ajellomyces dermatitidis ATCC 18188] gi|531977607|gb|EQL28194.1| 60S ribosomal protein L20 [Ajellomyces dermatitidis ATCC 26199] Length = 174 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 RRPYIKQLLTKDLKFPLPHRVPPKSGKKIFAATRPNTF 114 RRPYIKQLLTK+LKFPLPHRVP + KK+FAA RP+TF Sbjct: 136 RRPYIKQLLTKNLKFPLPHRVPKATTKKLFAAQRPSTF 173