BLASTX nr result
ID: Cocculus23_contig00055743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055743 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] 56 6e-06 ref|XP_004505733.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 636 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 42/55 (76%) Frame = +3 Query: 105 LLRCSKKISTMRELKQAQALITKAGLTNHSLLLAKLITFSALSTSGSLEYATAIF 269 LL +++S+++E++Q Q LITK+GL NH +++K+I+F +LS GSL YA AIF Sbjct: 115 LLSKLQQLSSVKEVEQTQCLITKSGLFNHPFVISKIISFLSLSPLGSLVYAQAIF 169 >emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] Length = 633 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 42/55 (76%) Frame = +3 Query: 105 LLRCSKKISTMRELKQAQALITKAGLTNHSLLLAKLITFSALSTSGSLEYATAIF 269 LL +++S+++E++Q Q LITK+GL NH +++K+I+F +LS GSL YA AIF Sbjct: 9 LLSKLQQLSSVKEVEQTQCLITKSGLFNHPFVISKIISFLSLSPLGSLVYAQAIF 63 >ref|XP_004505733.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cicer arietinum] Length = 544 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 123 KISTMRELKQAQALITKAGLTNHSLLLAKLITFSALSTSGSLEYATAIF 269 K+S+M +LKQ QA+ITK+GL +H K I FSALST G+L YA ++F Sbjct: 15 KLSSMSQLKQLQAIITKSGLHSHITFTTKFIFFSALSTMGNLSYAYSLF 63