BLASTX nr result
ID: Cocculus23_contig00055730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055730 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC97866.1| hypothetical protein BAUCODRAFT_31870 [Baudoinia ... 57 3e-06 >gb|EMC97866.1| hypothetical protein BAUCODRAFT_31870 [Baudoinia compniacensis UAMH 10762] Length = 309 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -2 Query: 468 LIWGHRNIDPASLGLRIVDYTERDASYVEKKAHSDTTTNGASTNGVTNGTS 316 LIWGHR IDPA LGL I DY E+D + +E K TNG TNG+TNG S Sbjct: 256 LIWGHRGIDPARLGLHIHDYDEKDLA-IEMKRPGANGTNG-HTNGITNGNS 304