BLASTX nr result
ID: Cocculus23_contig00055718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055718 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300438.2| hypothetical protein POPTR_0001s38890g [Popu... 60 2e-07 ref|XP_004500104.1| PREDICTED: genome polyprotein-like [Cicer ar... 60 4e-07 ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer ar... 60 4e-07 >ref|XP_002300438.2| hypothetical protein POPTR_0001s38890g [Populus trichocarpa] gi|550349213|gb|EEE85243.2| hypothetical protein POPTR_0001s38890g [Populus trichocarpa] Length = 309 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +2 Query: 2 SFPKMLEYKNKLIPHPQLLSLKDWFSQYQLTVKHIPGSTKNI 127 SFPKML++K K++PHPQLL L +WF +Y TV+HI G TKN+ Sbjct: 98 SFPKMLQFKRKMLPHPQLLRLAEWFPKYTFTVEHIKG-TKNL 138 >ref|XP_004500104.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 1170 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 2 SFPKMLEYKNKLIPHPQLLSLKDWFSQYQLTVKHIPGS 115 SFP++LE+KNK+ P PQ L LKDWFS+Y TVKHI G+ Sbjct: 1045 SFPRILEFKNKMPPDPQTLRLKDWFSRYDFTVKHIKGN 1082 >ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 1951 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 2 SFPKMLEYKNKLIPHPQLLSLKDWFSQYQLTVKHIPGS 115 SFP++LE+KNK+ P PQ L LKDWFS+Y TVKHI G+ Sbjct: 1712 SFPRILEFKNKMPPDPQTLRLKDWFSRYDFTVKHIKGN 1749