BLASTX nr result
ID: Cocculus23_contig00055608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055608 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96962.1| hypothetical protein BAUCODRAFT_68260, partial [B... 82 6e-14 gb|EMF12092.1| 60S ribosomal protein L23 [Sphaerulina musiva SO2... 82 1e-13 ref|XP_001549849.1| 60S ribosomal protein L25 [Botryotinia fucke... 80 3e-13 gb|EME82329.1| hypothetical protein MYCFIDRAFT_52665 [Pseudocerc... 79 7e-13 ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [... 79 9e-13 ref|XP_001597937.1| 60S ribosomal protein L25 [Sclerotinia scler... 78 1e-12 gb|EME43398.1| hypothetical protein DOTSEDRAFT_72709 [Dothistrom... 78 1e-12 gb|ESZ92287.1| 60S ribosomal protein L25 [Sclerotinia borealis F... 77 2e-12 ref|XP_003850458.1| 60S ribosomal protein L25 [Zymoseptoria trit... 77 2e-12 gb|EFY91950.1| 60S ribosomal protein L25 [Metarhizium acridum CQ... 77 3e-12 gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15e [Glarea loz... 75 1e-11 ref|XP_002544514.1| 60S ribosomal protein L23a [Uncinocarpus ree... 75 1e-11 ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunne... 74 3e-11 ref|XP_001242474.1| 60S ribosomal protein L25 [Coccidioides immi... 74 3e-11 gb|EER40835.1| 60S ribosomal protein L23 [Ajellomyces capsulatus... 73 5e-11 gb|EEH10523.1| 60S ribosomal protein L23 [Ajellomyces capsulatus... 73 5e-11 gb|ETN40787.1| hypothetical protein HMPREF1541_05067 [Cyphelloph... 72 6e-11 gb|ELR02173.1| large subunit ribosomal protein L23Ae [Pseudogymn... 72 6e-11 gb|EFZ03522.1| 60S ribosomal protein L25 [Metarhizium anisopliae... 72 6e-11 ref|XP_002790848.1| 60S ribosomal protein L25 [Paracoccidioides ... 72 6e-11 >gb|EMC96962.1| hypothetical protein BAUCODRAFT_68260, partial [Baudoinia compniacensis UAMH 10762] Length = 145 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHKVRK+RT+T+F RPKTLTLSR P+YPR+S+ +PRLDAGKV+IH Sbjct: 20 VNSHKVRKVRTNTSFHRPKTLTLSRAPKYPRKSVPHEPRLDAGKVIIH 67 >gb|EMF12092.1| 60S ribosomal protein L23 [Sphaerulina musiva SO2202] Length = 154 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHKV K+R STTF +PKTLTLSR P+YPRRSI QPRLDAGKV+IH Sbjct: 29 VNSHKVTKVRKSTTFHQPKTLTLSRAPKYPRRSIPRQPRLDAGKVIIH 76 >ref|XP_001549849.1| 60S ribosomal protein L25 [Botryotinia fuckeliana B05.10] gi|347836681|emb|CCD51253.1| similar to 60S ribosomal protein L23a [Botryotinia fuckeliana T4] gi|472237476|gb|EMR82371.1| putative 60s ribosomal protein l25 protein [Botryotinia fuckeliana BcDW1] Length = 154 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRK+R STTFRRPKTL LSR P+YPR SIVSQPRLD KV+IH Sbjct: 29 VHSHKVRKVRLSTTFRRPKTLQLSRAPKYPRTSIVSQPRLDEHKVIIH 76 >gb|EME82329.1| hypothetical protein MYCFIDRAFT_52665 [Pseudocercospora fijiensis CIRAD86] Length = 159 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHKV K+R ST+F PKTLT+SR P+YPR+SI SQPRLDAGKV+IH Sbjct: 34 VNSHKVTKVRKSTSFHLPKTLTISRAPKYPRKSIPSQPRLDAGKVIIH 81 >ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] gi|485917148|gb|EOD44201.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] Length = 150 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHKVRK+R STTF RPKTL LSR P+YPR+SI +PRLDA KV++H Sbjct: 25 VNSHKVRKVRNSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDASKVIVH 72 >ref|XP_001597937.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70] gi|154690885|gb|EDN90623.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70] Length = 154 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRK+R STTF RPKTL LSR P+YPR SIVSQPRLD KV+IH Sbjct: 29 VHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRTSIVSQPRLDEHKVIIH 76 >gb|EME43398.1| hypothetical protein DOTSEDRAFT_72709 [Dothistroma septosporum NZE10] Length = 160 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHK K+R STTF PKTLTLSR P+YPRRSI +PRLDAGKV++H Sbjct: 35 VNSHKTHKVRKSTTFHLPKTLTLSRAPKYPRRSIPREPRLDAGKVIVH 82 >gb|ESZ92287.1| 60S ribosomal protein L25 [Sclerotinia borealis F-4157] Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRK+R STTF RPKTL LSR P+YPR SI+SQPRLD K++IH Sbjct: 29 VHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRTSIISQPRLDEHKIIIH 76 >ref|XP_003850458.1| 60S ribosomal protein L25 [Zymoseptoria tritici IPO323] gi|339470336|gb|EGP85434.1| hypothetical protein MYCGRDRAFT_105388 [Zymoseptoria tritici IPO323] Length = 155 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VNSHK K+R ST+F PKTLTLSR P+YPR+S+ SQPRLDAGK++IH Sbjct: 30 VNSHKTTKVRKSTSFHLPKTLTLSRAPKYPRKSVPSQPRLDAGKIIIH 77 >gb|EFY91950.1| 60S ribosomal protein L25 [Metarhizium acridum CQMa 102] Length = 174 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -1 Query: 157 PVLQVNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 P+LQ ++HK RK+RTST+F RPKTL LSR P+YPR+SI QPRLD K++IH Sbjct: 45 PLLQTHAHKQRKVRTSTSFHRPKTLVLSRAPKYPRKSIPHQPRLDEHKIVIH 96 >gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 20868] Length = 156 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRK+R STTF RPKTL LSR+P+YPR+S+ QPRLD KV+IH Sbjct: 31 VHSHKVRKVRKSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVIIH 78 >ref|XP_002544514.1| 60S ribosomal protein L23a [Uncinocarpus reesii 1704] gi|237904784|gb|EEP79185.1| 60S ribosomal protein L23a [Uncinocarpus reesii 1704] Length = 174 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/53 (62%), Positives = 44/53 (83%) Frame = -1 Query: 160 RPVLQVNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 + +QV+SHKV+K+RTSTTF RPKTL LSR+P+YPR+SI + RLD KV++H Sbjct: 44 KSAMQVHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVH 96 >ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861776|gb|EKD14829.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 168 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRK+R STTF RPKTL LSR P+YPR+S+ +PRLD KV+IH Sbjct: 43 VHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRKSVPHEPRLDEHKVIIH 90 >ref|XP_001242474.1| 60S ribosomal protein L25 [Coccidioides immitis RS] gi|320040873|gb|EFW22806.1| 60S ribosomal protein L23 [Coccidioides posadasii str. Silveira] Length = 155 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -1 Query: 148 QVNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 QV+SHKV+K+RTSTTF RPKTL LSR+P+YPR+SI + RLD KV++H Sbjct: 29 QVHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVH 77 >gb|EER40835.1| 60S ribosomal protein L23 [Ajellomyces capsulatus H143] gi|325091756|gb|EGC45066.1| 60S ribosomal protein [Ajellomyces capsulatus H88] Length = 153 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRKIRTSTTF RPKTL LSR+P+YPR+SI + RLD K+++H Sbjct: 28 VHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVH 75 >gb|EEH10523.1| 60S ribosomal protein L23 [Ajellomyces capsulatus G186AR] Length = 153 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHKVRKIRTSTTF RPKTL LSR+P+YPR+SI + RLD K+++H Sbjct: 28 VHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVH 75 >gb|ETN40787.1| hypothetical protein HMPREF1541_05067 [Cyphellophora europaea CBS 101466] Length = 155 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 VN++K RKIRTSTTF RPKTL LSR+P+YPR+S+ +PRLD KV++H Sbjct: 30 VNANKARKIRTSTTFHRPKTLQLSRSPKYPRKSVPHEPRLDHHKVIVH 77 >gb|ELR02173.1| large subunit ribosomal protein L23Ae [Pseudogymnoascus destructans 20631-21] Length = 156 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V+SHK RK+R STTF RPKTL LSR+P+YPR+SI QPRLD +V+IH Sbjct: 31 VHSHKARKVRLSTTFHRPKTLILSRSPKYPRKSIPHQPRLDEHQVIIH 78 >gb|EFZ03522.1| 60S ribosomal protein L25 [Metarhizium anisopliae ARSEF 23] Length = 174 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -1 Query: 151 LQVNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 LQ ++HK RK+RTST+F +PKTL LSR P+YPR+SI QPRLD K++IH Sbjct: 47 LQTHAHKQRKVRTSTSFHQPKTLVLSRAPKYPRKSIPHQPRLDEHKIVIH 96 >ref|XP_002790848.1| 60S ribosomal protein L25 [Paracoccidioides sp. 'lutzii' Pb01] gi|225685072|gb|EEH23356.1| 60S ribosomal protein L25 [Paracoccidioides brasiliensis Pb03] gi|226281401|gb|EEH36967.1| 60S ribosomal protein L23a [Paracoccidioides sp. 'lutzii' Pb01] gi|226294384|gb|EEH49804.1| 60S ribosomal protein L23a [Paracoccidioides brasiliensis Pb18] Length = 153 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -1 Query: 145 VNSHKVRKIRTSTTFRRPKTLTLSRTPRYPRRSIVSQPRLDAGKVLIH 2 V++HKVRKIRTSTTF RPKTL LSR+P+YPR+SI + RLD K++IH Sbjct: 28 VHAHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDQHKIIIH 75