BLASTX nr result
ID: Cocculus23_contig00055469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055469 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF15187.1| hypothetical protein SEPMUDRAFT_147128 [Sphaeruli... 93 3e-17 gb|EME47340.1| hypothetical protein DOTSEDRAFT_69312 [Dothistrom... 90 3e-16 ref|XP_002148658.1| conserved hypothetical protein [Talaromyces ... 87 2e-15 ref|XP_002485587.1| conserved hypothetical protein [Talaromyces ... 87 3e-15 gb|EME86444.1| hypothetical protein MYCFIDRAFT_54071 [Pseudocerc... 84 3e-14 ref|XP_007289462.1| endoplasmic reticulum protein [Marssonina br... 83 5e-14 ref|XP_003848773.1| hypothetical protein MYCGRDRAFT_48345 [Zymos... 82 6e-14 gb|EMR82031.1| putative endoplasmic reticulum protein [Botryotin... 82 8e-14 emb|CCD47111.1| hypothetical protein BofuT4_P002700.1 [Botryotin... 82 8e-14 ref|XP_007582719.1| putative endoplasmic reticulum protein [Neof... 81 2e-13 gb|ETN43764.1| hypothetical protein HMPREF1541_11088 [Cyphelloph... 80 2e-13 gb|EGY16789.1| hypothetical protein VDAG_07953 [Verticillium dah... 80 2e-13 ref|XP_003009625.1| conserved hypothetical protein [Verticillium... 80 2e-13 gb|ESZ93337.1| putative Pore membrane protein of 33 kDa [Sclerot... 80 3e-13 gb|EPE06491.1| endoplasmic reticulum protein [Ophiostoma piceae ... 80 3e-13 gb|EKG14031.1| hypothetical protein MPH_08773 [Macrophomina phas... 80 4e-13 gb|EYE98655.1| hypothetical protein EURHEDRAFT_408994 [Aspergill... 79 7e-13 gb|EXJ54094.1| hypothetical protein A1O7_09431 [Cladophialophora... 79 7e-13 gb|EFX05695.1| hypothetical protein CMQ_3764 [Grosmannia clavige... 79 7e-13 ref|XP_001803674.1| hypothetical protein SNOG_13462 [Phaeosphaer... 79 7e-13 >gb|EMF15187.1| hypothetical protein SEPMUDRAFT_147128 [Sphaerulina musiva SO2202] Length = 280 Score = 93.2 bits (230), Expect = 3e-17 Identities = 48/70 (68%), Positives = 49/70 (70%) Frame = -3 Query: 212 MPQPTATXXXXXXXXXXXXXQTLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYR 33 M P AT QTLQF WFVGHVTLLL T+RY LSYIFFNYYSK AQFSYR Sbjct: 1 MAPPAATASQPLQERLLNLAQTLQFAWFVGHVTLLLTTIRYSLSYIFFNYYSKWAQFSYR 60 Query: 32 LAFIAAAATY 3 AFIAAAATY Sbjct: 61 TAFIAAAATY 70 >gb|EME47340.1| hypothetical protein DOTSEDRAFT_69312 [Dothistroma septosporum NZE10] Length = 281 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WF+GHVTLLLCT+RYGLSY+F YYS+ AQFSYR AFIAAAATY Sbjct: 22 TLQFAWFIGHVTLLLCTLRYGLSYVFLKYYSRWAQFSYRTAFIAAAATY 70 >ref|XP_002148658.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210068400|gb|EEA22491.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] Length = 289 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGH+TLLL RYGLSYIFFNYYS+ A+ SYRLAFI+AAATY Sbjct: 21 TLQFGWFVGHLTLLLSVFRYGLSYIFFNYYSRWAKISYRLAFISAAATY 69 >ref|XP_002485587.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218716212|gb|EED15634.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 289 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGH+TLLL RYGLSY+FFNYYS+ A+ SYRLAFI+AAATY Sbjct: 21 TLQFGWFVGHLTLLLSVFRYGLSYVFFNYYSRWAKISYRLAFISAAATY 69 >gb|EME86444.1| hypothetical protein MYCFIDRAFT_54071 [Pseudocercospora fijiensis CIRAD86] Length = 280 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/49 (81%), Positives = 41/49 (83%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WFVGHVTLLL T RY LSYIF YYS+ AQFSYR AFIAAAATY Sbjct: 20 TLQFAWFVGHVTLLLTTTRYTLSYIFLKYYSRWAQFSYRTAFIAAAATY 68 >ref|XP_007289462.1| endoplasmic reticulum protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866582|gb|EKD19621.1| endoplasmic reticulum protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 281 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGHV+LL C VRYG SYI FNYYS+ +FSYR AF++AA TY Sbjct: 21 TLQFGWFVGHVSLLFCIVRYGFSYISFNYYSRWGRFSYRTAFVSAAVTY 69 >ref|XP_003848773.1| hypothetical protein MYCGRDRAFT_48345 [Zymoseptoria tritici IPO323] gi|339468649|gb|EGP83749.1| hypothetical protein MYCGRDRAFT_48345 [Zymoseptoria tritici IPO323] Length = 281 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/70 (57%), Positives = 45/70 (64%) Frame = -3 Query: 212 MPQPTATXXXXXXXXXXXXXQTLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYR 33 M P AT QTLQF WF+GHVTLL T+RY LSY+ F YYS+ AQFSYR Sbjct: 1 MAPPAATAGQSLQERLLTVAQTLQFAWFIGHVTLLFSTIRYSLSYVTFKYYSRWAQFSYR 60 Query: 32 LAFIAAAATY 3 AF+AAA TY Sbjct: 61 TAFVAAAVTY 70 >gb|EMR82031.1| putative endoplasmic reticulum protein [Botryotinia fuckeliana BcDW1] Length = 280 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WFVGHV+LL C +RYGLSYI FNYYS+ A FSYR AFI+AA TY Sbjct: 21 TLQFAWFVGHVSLLFCILRYGLSYITFNYYSRWATFSYRTAFISAAVTY 69 >emb|CCD47111.1| hypothetical protein BofuT4_P002700.1 [Botryotinia fuckeliana T4] Length = 280 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WFVGHV+LL C +RYGLSYI FNYYS+ A FSYR AFI+AA TY Sbjct: 21 TLQFAWFVGHVSLLFCILRYGLSYITFNYYSRWATFSYRTAFISAAVTY 69 >ref|XP_007582719.1| putative endoplasmic reticulum protein [Neofusicoccum parvum UCRNP2] gi|485925176|gb|EOD49810.1| putative endoplasmic reticulum protein [Neofusicoccum parvum UCRNP2] Length = 279 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WF GH+TLL CT+RY LS++ FNYYS+ A+FSYRLAF+AAA TY Sbjct: 21 TLQFAWFGGHLTLLFCTLRYSLSWLTFNYYSRMARFSYRLAFVAAAVTY 69 >gb|ETN43764.1| hypothetical protein HMPREF1541_11088 [Cyphellophora europaea CBS 101466] Length = 287 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWF+GH TLL RYG+SYI FNYYS+ AQ SYRLAF++A ATY Sbjct: 21 TLQFGWFIGHATLLFAVFRYGMSYITFNYYSRWAQISYRLAFLSAVATY 69 >gb|EGY16789.1| hypothetical protein VDAG_07953 [Verticillium dahliae VdLs.17] Length = 286 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWF GH L+LCT+RYG S+I NYYS AQFSYR AF+AAA TY Sbjct: 21 TLQFGWFAGHAVLILCTIRYGFSWIRLNYYSGMAQFSYRTAFVAAAVTY 69 >ref|XP_003009625.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261352771|gb|EEY15199.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 221 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWF GH L+LCT+RYG S+I NYYS AQFSYR AF+AAA TY Sbjct: 21 TLQFGWFAGHAVLILCTIRYGFSWIRLNYYSGMAQFSYRTAFVAAAVTY 69 >gb|ESZ93337.1| putative Pore membrane protein of 33 kDa [Sclerotinia borealis F-4157] Length = 281 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WFVGH++LL C RYGLSYI FNYYS+ A FSYR AFI+AA TY Sbjct: 21 TLQFAWFVGHLSLLFCIFRYGLSYITFNYYSRWATFSYRTAFISAAVTY 69 >gb|EPE06491.1| endoplasmic reticulum protein [Ophiostoma piceae UAMH 11346] Length = 286 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGH+TL+LCT+RY LS++ FN YS A+ SYRLAF+AAAATY Sbjct: 21 TLQFGWFVGHLTLILCTLRYSLSWVRFNSYSFAARSSYRLAFVAAAATY 69 >gb|EKG14031.1| hypothetical protein MPH_08773 [Macrophomina phaseolina MS6] Length = 278 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WF GH+TLL CT+RY LS++ FNYYS+ A+FSYRLAF++AA TY Sbjct: 21 TLQFAWFGGHLTLLFCTLRYSLSWLTFNYYSRMARFSYRLAFVSAAVTY 69 >gb|EYE98655.1| hypothetical protein EURHEDRAFT_408994 [Aspergillus ruber CBS 135680] Length = 275 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGH+TLLL RY LSY FNYYS AQ SYR AFI+AAATY Sbjct: 21 TLQFGWFVGHLTLLLSVARYFLSYFTFNYYSSAAQVSYRFAFISAAATY 69 >gb|EXJ54094.1| hypothetical protein A1O7_09431 [Cladophialophora yegresii CBS 114405] Length = 286 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WF GH TLLL +RYGLSYI FNYYS+ AQF+YRLAF +A ATY Sbjct: 21 TLQFAWFCGHFTLLLSVLRYGLSYITFNYYSRWAQFTYRLAFTSAVATY 69 >gb|EFX05695.1| hypothetical protein CMQ_3764 [Grosmannia clavigera kw1407] Length = 285 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQFGWFVGH+TL+L T+RY LS+I FNYY A+FSYR AF+AAAATY Sbjct: 21 TLQFGWFVGHLTLILSTLRYSLSWIRFNYYGFFARFSYRTAFVAAAATY 69 >ref|XP_001803674.1| hypothetical protein SNOG_13462 [Phaeosphaeria nodorum SN15] gi|111058226|gb|EAT79346.1| hypothetical protein SNOG_13462 [Phaeosphaeria nodorum SN15] Length = 279 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -3 Query: 149 TLQFGWFVGHVTLLLCTVRYGLSYIFFNYYSKTAQFSYRLAFIAAAATY 3 TLQF WF GHVTLLL T+RY LSYI FNYYS+ A FSYR+AF++A TY Sbjct: 21 TLQFAWFAGHVTLLLATLRYSLSYITFNYYSRWASFSYRVAFLSACVTY 69