BLASTX nr result
ID: Cocculus23_contig00055258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00055258 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 64 2e-08 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/92 (40%), Positives = 53/92 (57%) Frame = +1 Query: 7 SSTFLKVGNGNSIQF*EDKFCGDSTLAYSHPSLYRLSSHHNMSFASFISCLDPILPNSHI 186 S LK+GNG ++F ED++ G+ +LA S +L+RLS+ HN + +SF S + Sbjct: 255 SHVILKIGNGRRVRFWEDEWAGEESLAASFSNLFRLSNLHNQAISSFYSI------GNDA 308 Query: 187 CPYWNFQFQRNFS*REEQEIDSLLSHLVHARI 282 WNF F+RN S RE E+ LLS L R+ Sbjct: 309 TISWNFHFRRNPSERELGEVVGLLSCLEGVRV 340