BLASTX nr result
ID: Cocculus23_contig00054628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054628 (598 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004510774.1| PREDICTED: cytochrome P450 86A2-like [Cicer ... 62 1e-07 ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase... 62 1e-07 ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis]... 62 2e-07 ref|XP_004306772.1| PREDICTED: cytochrome P450 86A2-like [Fragar... 61 3e-07 ref|XP_006445018.1| hypothetical protein CICLE_v10019633mg [Citr... 60 4e-07 gb|EXB30873.1| Cytochrome P450 86A2 [Morus notabilis] 58 2e-06 ref|XP_006583288.1| PREDICTED: cytochrome P450 86A8-like [Glycin... 58 2e-06 ref|XP_007135090.1| hypothetical protein PHAVU_010G099900g [Phas... 58 2e-06 ref|XP_003521880.1| PREDICTED: cytochrome P450 86A8-like [Glycin... 58 2e-06 ref|XP_007051775.1| Cytochrome P450, family 86, subfamily A, pol... 57 5e-06 ref|XP_007218993.1| hypothetical protein PRUPE_ppa004034mg [Prun... 57 5e-06 gb|EYU32135.1| hypothetical protein MIMGU_mgv1a003916mg [Mimulus... 56 9e-06 >ref|XP_004510774.1| PREDICTED: cytochrome P450 86A2-like [Cicer arietinum] Length = 539 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 MET T LLL TAI AYLLWF+FISRSL+GPRVWP Sbjct: 1 METCTALLLLTAITAYLLWFTFISRSLRGPRVWP 34 >ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] gi|355521588|gb|AET02042.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] Length = 540 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 MET T LLL TAI AYLLWF+FISRSL+GPRVWP Sbjct: 1 METCTALLLLTAITAYLLWFTFISRSLRGPRVWP 34 >ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis] gi|223549055|gb|EEF50544.1| cytochrome P450, putative [Ricinus communis] Length = 522 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 491 YHMETYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 Y M+ T L+LF+A+ AYLLWF+FISRSLKGPRVWP Sbjct: 6 YTMDVSTALMLFSAVTAYLLWFTFISRSLKGPRVWP 41 >ref|XP_004306772.1| PREDICTED: cytochrome P450 86A2-like [Fragaria vesca subsp. vesca] Length = 553 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 ME T LLLFTA+ YLLWF+FISRSLKGPRVWP Sbjct: 1 MEIGTALLLFTAVTVYLLWFTFISRSLKGPRVWP 34 >ref|XP_006445018.1| hypothetical protein CICLE_v10019633mg [Citrus clementina] gi|568876109|ref|XP_006491128.1| PREDICTED: cytochrome P450 86A2-like [Citrus sinensis] gi|557547280|gb|ESR58258.1| hypothetical protein CICLE_v10019633mg [Citrus clementina] Length = 539 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 M+ T LLFTA+ AYLLWF+FISRSLKGPRVWP Sbjct: 1 MDAATAFLLFTAVTAYLLWFTFISRSLKGPRVWP 34 >gb|EXB30873.1| Cytochrome P450 86A2 [Morus notabilis] Length = 556 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 ME T LLL TAI YLLWF+FISR+LKGPRVWP Sbjct: 1 MEISTALLLLTAITVYLLWFTFISRTLKGPRVWP 34 >ref|XP_006583288.1| PREDICTED: cytochrome P450 86A8-like [Glycine max] Length = 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVW 595 MET T LL TAI AYL+WF+FISRSLKGPRVW Sbjct: 1 METCTALLFLTAITAYLIWFTFISRSLKGPRVW 33 >ref|XP_007135090.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris] gi|561008135|gb|ESW07084.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris] Length = 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVW 595 MET T LL TAI AYL+WF+FISRSLKGPRVW Sbjct: 1 METSTALLFLTAITAYLIWFTFISRSLKGPRVW 33 >ref|XP_003521880.1| PREDICTED: cytochrome P450 86A8-like [Glycine max] Length = 533 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVW 595 MET T LL TAI AYL+WF+FISRSLKGPRVW Sbjct: 1 METCTALLFLTAITAYLIWFTFISRSLKGPRVW 33 >ref|XP_007051775.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 1 [Theobroma cacao] gi|590722004|ref|XP_007051776.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 1 [Theobroma cacao] gi|508704036|gb|EOX95932.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 1 [Theobroma cacao] gi|508704037|gb|EOX95933.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 1 [Theobroma cacao] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 M+ T LLL AI AYLLWF+FISRSL+GPRVWP Sbjct: 1 MDISTALLLLAAITAYLLWFTFISRSLRGPRVWP 34 >ref|XP_007218993.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica] gi|462415455|gb|EMJ20192.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica] Length = 534 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 ME T LL+ TAI AYLLWF+FISRSLKGP VWP Sbjct: 1 MEIGTALLVLTAITAYLLWFTFISRSLKGPGVWP 34 >gb|EYU32135.1| hypothetical protein MIMGU_mgv1a003916mg [Mimulus guttatus] Length = 555 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 497 METYTVLLLFTAIVAYLLWFSFISRSLKGPRVWP 598 M+ LLLFTA+ YLLWF+FIS+SL+GPRVWP Sbjct: 1 MDVSLALLLFTAVTCYLLWFTFISKSLRGPRVWP 34