BLASTX nr result
ID: Cocculus23_contig00054551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054551 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACM43473.1| cytochrome oxidase subunit 1 [Penicillium sclerot... 169 5e-40 ref|YP_008965386.1| Cox1 (mitochondrion) [Rhynchosporium orthosp... 168 8e-40 ref|YP_008965340.1| Cox1 (mitochondrion) [Rhynchosporium commune... 168 8e-40 ref|YP_008965293.1| Cox1 (mitochondrion) [Rhynchosporium agropyr... 168 8e-40 gb|AER27895.1| cytochrome oxidase subunit 1, partial (mitochondr... 168 8e-40 gb|AER27894.1| cytochrome oxidase subunit 1, partial (mitochondr... 168 8e-40 ref|YP_004733034.1| cytochrome c oxidase subunit I (mitochondrio... 168 8e-40 ref|YP_001648742.1| cytochrome oxidase subunit 1 [Zymoseptoria t... 166 3e-39 gb|AFD95917.1| cytochrome oxidase subunit 1 (mitochondrion) [Tal... 164 9e-39 gb|ACM43480.1| cytochrome oxidase subunit 1 [Talaromyces verrucu... 164 9e-39 ref|NP_943723.1| cytochrome-c oxidase subunit 1 (mitochondrion) ... 164 1e-38 ref|YP_005351217.1| cytochrome c oxidase subunit 1 (mitochondrio... 164 1e-38 ref|YP_005351176.1| cytochrome c oxidase subunit 1 (mitochondrio... 164 1e-38 gb|AGN74495.1| cytochrome c oxidase subunit I (mitochondrion) [G... 164 2e-38 ref|YP_002970891.1| cytochrome oxidase subunit 1 [Microsporum ca... 162 5e-38 ref|YP_002970835.1| cytochrome oxidase subunit 1 [Arthroderma un... 162 5e-38 gb|AFD95962.1| cytochrome oxidase subunit 1 (mitochondrion) [Pen... 161 8e-38 ref|YP_004935028.1| cox1 gene product (mitochondrion) [Penicilli... 161 8e-38 gb|ACM43468.1| cytochrome oxidase subunit 1 [Penicillium paxilli] 161 8e-38 gb|ACM43464.1| cytochrome oxidase subunit 1 [Talaromyces miniolu... 161 8e-38 >gb|ACM43473.1| cytochrome oxidase subunit 1 [Penicillium sclerotiorum] Length = 279 Score = 169 bits (427), Expect = 5e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKS+FGYLGMVYAMMSIGVLGFVV SHHMYSVGLDVDTRAYFTAA Sbjct: 106 IPGFGIISTTISASSNKSIFGYLGMVYAMMSIGVLGFVVWSHHMYSVGLDVDTRAYFTAA 165 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 166 TLIIAVPTGIKIFSWLATCYGGSLHLTP 193 >ref|YP_008965386.1| Cox1 (mitochondrion) [Rhynchosporium orthosporum] gi|564736911|gb|AHC02383.1| Cox1 (mitochondrion) [Rhynchosporium orthosporum] Length = 583 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 184 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 243 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 244 TLIIAVPTGIKIFSWLATCYGGSLHLTP 271 >ref|YP_008965340.1| Cox1 (mitochondrion) [Rhynchosporium commune] gi|564736864|gb|AHC02337.1| Cox1 (mitochondrion) [Rhynchosporium commune] Length = 583 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 184 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 243 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 244 TLIIAVPTGIKIFSWLATCYGGSLHLTP 271 >ref|YP_008965293.1| Cox1 (mitochondrion) [Rhynchosporium agropyri] gi|568192670|ref|YP_008965413.1| Cox1 (mitochondrion) [Rhynchosporium secalis] gi|564736816|gb|AHC02290.1| Cox1 (mitochondrion) [Rhynchosporium agropyri] gi|564736939|gb|AHC02410.1| Cox1 (mitochondrion) [Rhynchosporium secalis] Length = 583 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 184 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 243 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 244 TLIIAVPTGIKIFSWLATCYGGSLHLTP 271 >gb|AER27895.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Phialocephala helvetica] gi|354549908|gb|AER27896.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Phialocephala fortinii] gi|354549910|gb|AER27897.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Acephala applanata] Length = 362 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 125 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 184 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 185 TLIIAVPTGIKIFSWLATCYGGSLHLTP 212 >gb|AER27894.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Phialocephala europaea] Length = 362 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 125 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 184 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 185 TLIIAVPTGIKIFSWLATCYGGSLHLTP 212 >ref|YP_004733034.1| cytochrome c oxidase subunit I (mitochondrion) [Phialocephala subalpina] gi|336326758|gb|AEI52984.1| cytochrome oxidase subunit 1 (mitochondrion) [Phialocephala subalpina] Length = 573 Score = 168 bits (425), Expect = 8e-40 Identities = 85/88 (96%), Positives = 86/88 (97%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 286 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 345 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 346 TLIIAVPTGIKIFSWLATCYGGSLHLTP 373 >ref|YP_001648742.1| cytochrome oxidase subunit 1 [Zymoseptoria tritici] gi|155964391|gb|ABU40258.1| cytochrome oxidase subunit 1 (mitochondrion) [Zymoseptoria tritici] Length = 669 Score = 166 bits (420), Expect = 3e-39 Identities = 85/88 (96%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV SHHMYSVGLDVDTRAYFTAA Sbjct: 249 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYSVGLDVDTRAYFTAA 308 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSL LTP Sbjct: 309 TLIIAVPTGIKIFSWLATCYGGSLQLTP 336 >gb|AFD95917.1| cytochrome oxidase subunit 1 (mitochondrion) [Talaromyces stipitatus] Length = 559 Score = 164 bits (416), Expect = 9e-39 Identities = 83/88 (94%), Positives = 84/88 (95%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST ISA SNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 280 IPGFGIISTVISAGSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 339 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 340 TLIIAVPTGIKIFSWLATCYGGSLHLTP 367 >gb|ACM43480.1| cytochrome oxidase subunit 1 [Talaromyces verruculosus] Length = 279 Score = 164 bits (416), Expect = 9e-39 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST +SA+SNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 106 IPGFGIISTVVSAASNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 165 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 166 TLIIAVPTGIKIFSWLATCYGGSLHLTP 193 >ref|NP_943723.1| cytochrome-c oxidase subunit 1 (mitochondrion) [Talaromyces marneffei] gi|33860266|gb|AAQ54924.1| cytochrome-c oxidase subunit 1 (mitochondrion) [Talaromyces marneffei] gi|380702211|gb|AFD95981.1| cytochrome oxidase subunit 1 (mitochondrion) [Talaromyces marneffei] Length = 561 Score = 164 bits (415), Expect = 1e-38 Identities = 82/88 (93%), Positives = 84/88 (95%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST +SA SNKSVFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 282 IPGFGIISTVVSAGSNKSVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 341 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 342 TLIIAVPTGIKIFSWLATCYGGSLHLTP 369 >ref|YP_005351217.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera membranacea] gi|340536560|gb|AEK48332.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera membranacea] Length = 631 Score = 164 bits (415), Expect = 1e-38 Identities = 83/88 (94%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFG+ISTTISASSNKSVFGYLGMVYA+MSIGVLGFVV SHHMYSVGLDVDTRAYFTAA Sbjct: 274 IPGFGVISTTISASSNKSVFGYLGMVYAIMSIGVLGFVVWSHHMYSVGLDVDTRAYFTAA 333 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSL LTP Sbjct: 334 TLIIAVPTGIKIFSWLATCYGGSLQLTP 361 >ref|YP_005351176.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera malacea] gi|340536531|gb|AEK48304.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera malacea] Length = 627 Score = 164 bits (415), Expect = 1e-38 Identities = 83/88 (94%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFG+ISTTISASSNKSVFGYLGMVYA+MSIGVLGFVV SHHMYSVGLDVDTRAYFTAA Sbjct: 274 IPGFGVISTTISASSNKSVFGYLGMVYAIMSIGVLGFVVWSHHMYSVGLDVDTRAYFTAA 333 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSL LTP Sbjct: 334 TLIIAVPTGIKIFSWLATCYGGSLQLTP 361 >gb|AGN74495.1| cytochrome c oxidase subunit I (mitochondrion) [Glarea lozoyensis 74030] Length = 595 Score = 164 bits (414), Expect = 2e-38 Identities = 83/88 (94%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIISTTISASSNK+VFGYLGMVYAMMSIGVLGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 291 IPGFGIISTTISASSNKAVFGYLGMVYAMMSIGVLGFVVWSHHMYTVGLDVDTRAYFTAA 350 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSL LTP Sbjct: 351 TLIIAVPTGIKIFSWLATCYGGSLQLTP 378 >ref|YP_002970891.1| cytochrome oxidase subunit 1 [Microsporum canis] gi|237781140|gb|ACR19630.1| cytochrome oxidase subunit 1 [Arthroderma otae] Length = 528 Score = 162 bits (410), Expect = 5e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 +PGFGIIST ISASS+K+VFGYLGMVYAMMSIG+LGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 249 VPGFGIISTVISASSSKNVFGYLGMVYAMMSIGILGFVVWSHHMYTVGLDVDTRAYFTAA 308 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 309 TLIIAVPTGIKIFSWLATCYGGSLHLTP 336 >ref|YP_002970835.1| cytochrome oxidase subunit 1 [Arthroderma uncinatum] gi|237781103|gb|ACR19595.1| cytochrome oxidase subunit 1 [Arthroderma uncinatum] Length = 528 Score = 162 bits (410), Expect = 5e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 +PGFGIIST ISASS+K+VFGYLGMVYAMMSIG+LGFVV SHHMY+VGLDVDTRAYFTAA Sbjct: 249 VPGFGIISTVISASSSKNVFGYLGMVYAMMSIGILGFVVWSHHMYTVGLDVDTRAYFTAA 308 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 309 TLIIAVPTGIKIFSWLATCYGGSLHLTP 336 >gb|AFD95962.1| cytochrome oxidase subunit 1 (mitochondrion) [Penicillium chrysogenum] Length = 567 Score = 161 bits (408), Expect = 8e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST ISA+S+K+VFGYLGMVYAMMSIGVLGF+V SHHMY+VGLDVDTRAYFTAA Sbjct: 288 IPGFGIISTVISAASSKNVFGYLGMVYAMMSIGVLGFIVWSHHMYTVGLDVDTRAYFTAA 347 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 348 TLIIAVPTGIKIFSWLATCYGGSLHLTP 375 >ref|YP_004935028.1| cox1 gene product (mitochondrion) [Penicillium solitum] gi|354464890|gb|AER26652.1| cytochrome c oxidase subunit 1 (mitochondrion) [Penicillium solitum] Length = 573 Score = 161 bits (408), Expect = 8e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST ISA+S+K+VFGYLGMVYAMMSIGVLGF+V SHHMY+VGLDVDTRAYFTAA Sbjct: 294 IPGFGIISTVISAASSKNVFGYLGMVYAMMSIGVLGFIVWSHHMYTVGLDVDTRAYFTAA 353 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 354 TLIIAVPTGIKIFSWLATCYGGSLHLTP 381 >gb|ACM43468.1| cytochrome oxidase subunit 1 [Penicillium paxilli] Length = 278 Score = 161 bits (408), Expect = 8e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST ISA+S+K+VFGYLGMVYAMMSIGVLGF+V SHHMY+VGLDVDTRAYFTAA Sbjct: 106 IPGFGIISTVISAASSKNVFGYLGMVYAMMSIGVLGFIVWSHHMYTVGLDVDTRAYFTAA 165 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 166 TLIIAVPTGIKIFSWLATCYGGSLHLTP 193 >gb|ACM43464.1| cytochrome oxidase subunit 1 [Talaromyces minioluteus] Length = 277 Score = 161 bits (408), Expect = 8e-38 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -2 Query: 264 IPGFGIISTTISASSNKSVFGYLGMVYAMMSIGVLGFVV*SHHMYSVGLDVDTRAYFTAA 85 IPGFGIIST ISA+S+K+VFGYLGMVYAMMSIGVLGF+V SHHMY+VGLDVDTRAYFTAA Sbjct: 106 IPGFGIISTVISAASSKNVFGYLGMVYAMMSIGVLGFIVWSHHMYTVGLDVDTRAYFTAA 165 Query: 84 TLIIAVPTGIKIFS*LATCYGGSLHLTP 1 TLIIAVPTGIKIFS LATCYGGSLHLTP Sbjct: 166 TLIIAVPTGIKIFSWLATCYGGSLHLTP 193