BLASTX nr result
ID: Cocculus23_contig00054514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054514 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME89505.1| hypothetical protein MYCFIDRAFT_181565 [Pseudocer... 60 3e-07 >gb|EME89505.1| hypothetical protein MYCFIDRAFT_181565 [Pseudocercospora fijiensis CIRAD86] Length = 110 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = +3 Query: 144 YTDPSGTTTSRTS-QNLGGPVVHETRAYDSQGRE---LLSNGGGSANRRIEDVSDEEQ 305 YTD G TT +T+ QNLG PV+ +TR +DS G+E L + G + +RRIEDVSDE+Q Sbjct: 39 YTDSEGNTTVKTANQNLGEPVIQDTRHFDSSGQERVGALGSSGATTSRRIEDVSDEDQ 96