BLASTX nr result
ID: Cocculus23_contig00054404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054404 (564 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580233.1| putative glycine-rich cell wall structural p... 59 9e-07 gb|EME47544.1| hypothetical protein DOTSEDRAFT_69482 [Dothistrom... 56 7e-06 >ref|XP_007580233.1| putative glycine-rich cell wall structural protein 1 protein [Neofusicoccum parvum UCRNP2] gi|485928599|gb|EOD52284.1| putative glycine-rich cell wall structural protein 1 protein [Neofusicoccum parvum UCRNP2] Length = 320 Score = 58.9 bits (141), Expect = 9e-07 Identities = 30/61 (49%), Positives = 38/61 (62%) Frame = -3 Query: 454 KSGQEPVSGQEGKGTATEPFDQGNDQTDPNKSGKGAQNVTTEATDAVKNVVGSTKASGGA 275 +SGQEPVSGQ G+GTA EP+D GN + +P GK AQ T+ T + S SGG+ Sbjct: 23 QSGQEPVSGQTGRGTAEEPYDSGNLEGNPELGGKSAQETRTD-TSVPTSSAASNPLSGGS 81 Query: 274 A 272 A Sbjct: 82 A 82 >gb|EME47544.1| hypothetical protein DOTSEDRAFT_69482 [Dothistroma septosporum NZE10] Length = 436 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Frame = -3 Query: 457 AKSGQEPVSGQEGKGTATEPFDQGNDQTDPNKSGKGAQNVTT--EATDAVKNVVGSTKAS 284 A+SGQEP+SG +GKGTA+EPFDQGN Q +GK ++ + +A + +V S ++ Sbjct: 64 AESGQEPISGSQGKGTASEPFDQGNQQDKAGLAGKAPRHTDSQQQAPSSASPIVESLQSL 123 Query: 283 G 281 G Sbjct: 124 G 124