BLASTX nr result
ID: Cocculus23_contig00054275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054275 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME38250.1| hypothetical protein DOTSEDRAFT_75722 [Dothistrom... 62 1e-07 >gb|EME38250.1| hypothetical protein DOTSEDRAFT_75722 [Dothistroma septosporum NZE10] Length = 136 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +2 Query: 2 EGNIHRDEFGGHSKAQGEHKGESILDKAKHALGLDHHKKDEVPKT 136 EGN+H++++GGHS+ Q EH ES+LDKAKHA+GLD +K P T Sbjct: 91 EGNVHKEKYGGHSQPQKEHGKESLLDKAKHAVGLDKKEKTPEPST 135