BLASTX nr result
ID: Cocculus23_contig00054269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054269 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007143112.1| hypothetical protein PHAVU_007G044700g [Phas... 155 6e-36 ref|XP_007143105.1| hypothetical protein PHAVU_007G044000g [Phas... 155 7e-36 ref|XP_003555986.1| PREDICTED: mitotic checkpoint protein BUB3.1... 155 7e-36 ref|XP_003536585.1| PREDICTED: mitotic checkpoint protein BUB3.1... 155 7e-36 ref|NP_001239974.1| uncharacterized protein LOC100820541 [Glycin... 155 7e-36 ref|XP_006346313.1| PREDICTED: mitotic checkpoint protein BUB3.1... 154 1e-35 ref|XP_004230702.1| PREDICTED: mitotic checkpoint protein BUB3-l... 154 1e-35 ref|NP_566644.1| cell cycle arrest protein BUB3 [Arabidopsis th... 154 1e-35 ref|XP_006298078.1| hypothetical protein CARUB_v10014121mg [Caps... 154 1e-35 ref|XP_002883194.1| hypothetical protein ARALYDRAFT_898343 [Arab... 154 1e-35 gb|ABK21756.1| unknown [Picea sitchensis] gi|116781549|gb|ABK221... 154 2e-35 ref|XP_006422834.1| hypothetical protein CICLE_v10028761mg [Citr... 153 2e-35 ref|XP_004289802.1| PREDICTED: mitotic checkpoint protein BUB3-l... 153 2e-35 ref|XP_007201242.1| hypothetical protein PRUPE_ppa008206mg [Prun... 153 2e-35 gb|EXB80042.1| Mitotic checkpoint protein [Morus notabilis] 153 3e-35 ref|XP_007042628.1| Transducin/WD40 repeat-like superfamily prot... 153 3e-35 ref|XP_002527504.1| mitotic checkpoint protein bub3, putative [R... 153 3e-35 ref|XP_006849345.1| hypothetical protein AMTR_s00164p00065390 [A... 152 4e-35 ref|XP_004511310.1| PREDICTED: mitotic checkpoint protein BUB3-l... 152 5e-35 ref|XP_004156860.1| PREDICTED: mitotic checkpoint protein BUB3-l... 152 5e-35 >ref|XP_007143112.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris] gi|561016302|gb|ESW15106.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris] Length = 345 Score = 155 bits (392), Expect = 6e-36 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE++QAKKYAFKCHR+SEAGRDIVYPVN IA+HP+YGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDLSEAIQAKKYAFKCHRKSEAGRDIVYPVNAIAYHPVYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 259 TGGCDGYVNVWDGNNK 274 >ref|XP_007143105.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris] gi|561016295|gb|ESW15099.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris] Length = 342 Score = 155 bits (391), Expect = 7e-36 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 259 TGGCDGYVNVWDGNNK 274 >ref|XP_003555986.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max] Length = 340 Score = 155 bits (391), Expect = 7e-36 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 258 TGGCDGYVNVWDGNNK 273 >ref|XP_003536585.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max] Length = 340 Score = 155 bits (391), Expect = 7e-36 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 258 TGGCDGYVNVWDGNNK 273 >ref|NP_001239974.1| uncharacterized protein LOC100820541 [Glycine max] gi|255645545|gb|ACU23267.1| unknown [Glycine max] Length = 344 Score = 155 bits (391), Expect = 7e-36 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 258 TGGCDGYVNVWDGNNK 273 >ref|XP_006346313.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Solanum tuberosum] Length = 340 Score = 154 bits (390), Expect = 1e-35 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSES Q+KKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSESGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 258 TGGCDGYVNVWDGNNK 273 >ref|XP_004230702.1| PREDICTED: mitotic checkpoint protein BUB3-like [Solanum lycopersicum] Length = 340 Score = 154 bits (390), Expect = 1e-35 Identities = 71/76 (93%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSES Q+KKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSESGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 258 TGGCDGYVNVWDGNNK 273 >ref|NP_566644.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana] gi|75335082|sp|Q9LJN8.1|BUB31_ARATH RecName: Full=Mitotic checkpoint protein BUB3.1; AltName: Full=Protein BUDDING UNINHIBITED BY BENZYMIDAZOL 3.1 gi|9294423|dbj|BAB02543.1| mitotic checkpoint protein [Arabidopsis thaliana] gi|21593004|gb|AAM64953.1| mitotic checkpoint protein, putative [Arabidopsis thaliana] gi|28393726|gb|AAO42274.1| putative mitotic checkpoint protein [Arabidopsis thaliana] gi|29824353|gb|AAP04137.1| putative mitotic checkpoint protein [Arabidopsis thaliana] gi|332642742|gb|AEE76263.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana] Length = 340 Score = 154 bits (389), Expect = 1e-35 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN+IAFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VN+WDGNNK Sbjct: 258 TGGCDGFVNIWDGNNK 273 >ref|XP_006298078.1| hypothetical protein CARUB_v10014121mg [Capsella rubella] gi|482566787|gb|EOA30976.1| hypothetical protein CARUB_v10014121mg [Capsella rubella] Length = 339 Score = 154 bits (389), Expect = 1e-35 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN+IAFHPIYGTFA Sbjct: 197 GTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFA 256 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VN+WDGNNK Sbjct: 257 TGGCDGFVNIWDGNNK 272 >ref|XP_002883194.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. lyrata] gi|297329034|gb|EFH59453.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. lyrata] Length = 339 Score = 154 bits (389), Expect = 1e-35 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN+IAFHPIYGTFA Sbjct: 197 GTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFA 256 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VN+WDGNNK Sbjct: 257 TGGCDGFVNIWDGNNK 272 >gb|ABK21756.1| unknown [Picea sitchensis] gi|116781549|gb|ABK22148.1| unknown [Picea sitchensis] Length = 342 Score = 154 bits (388), Expect = 2e-35 Identities = 71/76 (93%), Positives = 73/76 (96%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTGFALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRD VYPVN IAFHPIYGTFA Sbjct: 201 GTGFALSSVEGRVAMEFFDLSEAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFA 260 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 261 TGGCDGYVNVWDGNNK 276 >ref|XP_006422834.1| hypothetical protein CICLE_v10028761mg [Citrus clementina] gi|568867185|ref|XP_006486924.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Citrus sinensis] gi|557524768|gb|ESR36074.1| hypothetical protein CICLE_v10028761mg [Citrus clementina] Length = 342 Score = 153 bits (387), Expect = 2e-35 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 200 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 259 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VNVWDGNNK Sbjct: 260 TGGCDGFVNVWDGNNK 275 >ref|XP_004289802.1| PREDICTED: mitotic checkpoint protein BUB3-like [Fragaria vesca subsp. vesca] Length = 341 Score = 153 bits (387), Expect = 2e-35 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ Q KKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDLSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 259 TGGCDGYVNVWDGNNK 274 >ref|XP_007201242.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica] gi|462396642|gb|EMJ02441.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica] Length = 341 Score = 153 bits (387), Expect = 2e-35 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ Q KKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDLSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 259 TGGCDGYVNVWDGNNK 274 >gb|EXB80042.1| Mitotic checkpoint protein [Morus notabilis] Length = 338 Score = 153 bits (386), Expect = 3e-35 Identities = 69/76 (90%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHP+YGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VNVWDGNNK Sbjct: 259 TGGCDGFVNVWDGNNK 274 >ref|XP_007042628.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508706563|gb|EOX98459.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 342 Score = 153 bits (386), Expect = 3e-35 Identities = 69/76 (90%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHP+YGTFA Sbjct: 200 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFA 259 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VNVWDGNNK Sbjct: 260 TGGCDGFVNVWDGNNK 275 >ref|XP_002527504.1| mitotic checkpoint protein bub3, putative [Ricinus communis] gi|223533144|gb|EEF34902.1| mitotic checkpoint protein bub3, putative [Ricinus communis] Length = 342 Score = 153 bits (386), Expect = 3e-35 Identities = 69/76 (90%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHP+YGTFA Sbjct: 200 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFA 259 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VNVWDGNNK Sbjct: 260 TGGCDGFVNVWDGNNK 275 >ref|XP_006849345.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda] gi|548852866|gb|ERN10926.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda] Length = 342 Score = 152 bits (385), Expect = 4e-35 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTGFALSSVEGRVAMEFFDLS++ QAKKYAFKCHR+SEAGRD VYPVN IAFHPIYGTFA Sbjct: 200 GTGFALSSVEGRVAMEFFDLSDAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFA 259 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 260 TGGCDGYVNVWDGNNK 275 >ref|XP_004511310.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cicer arietinum] Length = 340 Score = 152 bits (384), Expect = 5e-35 Identities = 69/76 (90%), Positives = 74/76 (97%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFDLSE+ QAKKYAFKCHR+SEAGRDIVYPVN +AFHPIYGTFA Sbjct: 198 GTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAMAFHPIYGTFA 257 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDG+VNVWDGNNK Sbjct: 258 TGGCDGFVNVWDGNNK 273 >ref|XP_004156860.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cucumis sativus] Length = 341 Score = 152 bits (384), Expect = 5e-35 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = -3 Query: 229 GTGFALSSVEGRVAMEFFDLSESVQAKKYAFKCHRRSEAGRDIVYPVNTIAFHPIYGTFA 50 GTG+ALSSVEGRVAMEFFD SE+ QAKKYAFKCHR+SEAGRDIVYPVN IAFHPIYGTFA Sbjct: 199 GTGYALSSVEGRVAMEFFDPSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFA 258 Query: 49 TGGCDGYVNVWDGNNK 2 TGGCDGYVNVWDGNNK Sbjct: 259 TGGCDGYVNVWDGNNK 274