BLASTX nr result
ID: Cocculus23_contig00054198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054198 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA29096.1| putative MYB transcription factor [Rosa rugosa] 57 3e-06 >emb|CCA29096.1| putative MYB transcription factor [Rosa rugosa] Length = 343 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Frame = -3 Query: 237 SYTPDENSSTAASSDSLGTQVSMVSDFTECCNGLQVENTSTSGVG-----ANTQIGHGGY 73 SYT ENSSTAASSDS GTQVS VS+ T+ + + V N S A GY Sbjct: 219 SYTTPENSSTAASSDSFGTQVSPVSELTDYYSNMSVNNNKPSSQALDYFQATNPHHQVGY 278 Query: 72 QECLTSPYGY 43 + +TSP GY Sbjct: 279 HDSMTSPSGY 288