BLASTX nr result
ID: Cocculus23_contig00054166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054166 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAA27396.3| hypothetical protein NCU05134 [Neurospora crassa ... 56 6e-06 >gb|EAA27396.3| hypothetical protein NCU05134 [Neurospora crassa OR74A] Length = 120 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/49 (48%), Positives = 28/49 (57%) Frame = -1 Query: 255 DLRKPCICPTPNCPPFLNPKSKCECLAQADLACHKATNGGCPSPLPKVC 109 D RK C NCPPFLN K+ CEC A A +A + + GCP P K C Sbjct: 72 DFRKQCKSLPSNCPPFLNKKAMCECRAAATVASYLESERGCPKPSQKAC 120