BLASTX nr result
ID: Cocculus23_contig00054089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00054089 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ENH79566.1| retinol dehydrogenase 12 [Colletotrichum orbicula... 58 1e-06 gb|EON61645.1| hypothetical protein W97_00861 [Coniosporium apol... 58 2e-06 >gb|ENH79566.1| retinol dehydrogenase 12 [Colletotrichum orbiculare MAFF 240422] Length = 346 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 3 PPAAPEPGSELAQDEQLAERMMKLTREVIADKTKKD 110 PPA PEPGS+LAQD++LA+R+M+LTR+VI +KTK D Sbjct: 297 PPAIPEPGSKLAQDDELADRLMELTRKVITEKTKSD 332 >gb|EON61645.1| hypothetical protein W97_00861 [Coniosporium apollinis CBS 100218] Length = 343 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +3 Query: 3 PPAAPEPGSELAQDEQLAERMMKLTREVIADKTKKD 110 PPA PEPGSE++QD++L ER+MKLTREV+ +KT+ D Sbjct: 297 PPAIPEPGSEMSQDKELGERLMKLTREVVMEKTRAD 332