BLASTX nr result
ID: Cocculus23_contig00053887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053887 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40270.1| hypothetical protein DOTSEDRAFT_28174 [Dothistrom... 67 2e-09 gb|EMF08990.1| hypothetical protein SEPMUDRAFT_151862 [Sphaeruli... 59 5e-07 >gb|EME40270.1| hypothetical protein DOTSEDRAFT_28174 [Dothistroma septosporum NZE10] Length = 72 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 239 IDPAKYRDKNEKFTDKVRSFFEKKTGKKVPDKFSN 135 IDPAKYR +NEKFTDK+R FFEKKTGKKVP+KFSN Sbjct: 38 IDPAKYRAQNEKFTDKLRGFFEKKTGKKVPEKFSN 72 >gb|EMF08990.1| hypothetical protein SEPMUDRAFT_151862 [Sphaerulina musiva SO2202] Length = 72 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 242 NIDPAKYRDKNEKFTDKVRSFFEKKTGKKVPDKFSN 135 N+DP KYR +NEK TDK+R F EK TGKK+P KFSN Sbjct: 37 NVDPQKYRAQNEKLTDKIRGFLEKATGKKMPSKFSN 72