BLASTX nr result
ID: Cocculus23_contig00053876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053876 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006420182.1| hypothetical protein CICLE_v10006571mg [Citr... 55 8e-06 >ref|XP_006420182.1| hypothetical protein CICLE_v10006571mg [Citrus clementina] gi|557522055|gb|ESR33422.1| hypothetical protein CICLE_v10006571mg [Citrus clementina] Length = 367 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 3 ENPPLYRATSVKEYVEYYDEKGLDGTSALTDFRL 104 ENPPLYR TSV++++ YY+ KGLDG SALT F+L Sbjct: 332 ENPPLYRETSVQDFIAYYESKGLDGNSALTHFKL 365