BLASTX nr result
ID: Cocculus23_contig00053858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053858 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC69712.1| ETTa [Nicotiana tabacum] 65 1e-08 ref|NP_001170123.1| uncharacterized protein LOC100384045 [Zea ma... 64 1e-08 tpg|DAA58195.1| TPA: hypothetical protein ZEAMMB73_535248 [Zea m... 64 1e-08 emb|CAN65414.1| hypothetical protein VITISV_009739 [Vitis vinifera] 64 2e-08 gb|EXC30555.1| Auxin response factor 3 [Morus notabilis] 64 2e-08 ref|XP_006364312.1| PREDICTED: auxin response factor 3-like isof... 64 2e-08 ref|XP_007025521.1| Transcriptional factor B3 family protein / a... 64 2e-08 ref|XP_006467718.1| PREDICTED: auxin response factor 3-like isof... 64 2e-08 ref|XP_006364315.1| PREDICTED: auxin response factor 3-like isof... 64 2e-08 ref|NP_001234316.1| auxin response factor 3 [Solanum lycopersicu... 64 2e-08 ref|XP_007025520.1| Transcriptional factor B3 family protein / a... 64 2e-08 ref|XP_006467719.1| PREDICTED: auxin response factor 3-like isof... 64 2e-08 ref|XP_007025518.1| Transcriptional factor B3 family protein / a... 64 2e-08 ref|XP_006449420.1| hypothetical protein CICLE_v10014391mg [Citr... 64 2e-08 ref|XP_006377428.1| hypothetical protein POPTR_0011s05830g [Popu... 64 2e-08 ref|XP_002273401.2| PREDICTED: auxin response factor 3-like [Vit... 64 2e-08 ref|XP_002440246.1| hypothetical protein SORBIDRAFT_09g028450 [S... 64 2e-08 ref|XP_006597463.1| PREDICTED: auxin response factor 3-like [Gly... 64 2e-08 gb|AFW79158.1| hypothetical protein ZEAMMB73_920641 [Zea mays] 64 2e-08 ref|XP_003543018.1| PREDICTED: auxin response factor 3-like [Gly... 64 2e-08 >gb|ABC69712.1| ETTa [Nicotiana tabacum] Length = 336 Score = 64.7 bits (156), Expect(2) = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVNRKKLVSGDAVLFLR Sbjct: 37 HIYRGQPRRHLLTTGWSAFVNRKKLVSGDAVLFLR 71 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 35 FRHIYRG 41 >ref|NP_001170123.1| uncharacterized protein LOC100384045 [Zea mays] gi|224033653|gb|ACN35902.1| unknown [Zea mays] gi|295844298|gb|ADG43146.1| auxin response factor 12 [Zea mays] gi|407232694|gb|AFT82689.1| ARF12 ARF type transcription factor, partial [Zea mays subsp. mays] gi|414881063|tpg|DAA58194.1| TPA: auxin response factor 12 [Zea mays] Length = 708 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVNRKKL+SGDAVLFLR Sbjct: 201 HIYRGQPRRHLLTTGWSAFVNRKKLISGDAVLFLR 235 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 199 FRHIYRG 205 >tpg|DAA58195.1| TPA: hypothetical protein ZEAMMB73_535248 [Zea mays] Length = 698 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVNRKKL+SGDAVLFLR Sbjct: 201 HIYRGQPRRHLLTTGWSAFVNRKKLISGDAVLFLR 235 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 199 FRHIYRG 205 >emb|CAN65414.1| hypothetical protein VITISV_009739 [Vitis vinifera] Length = 831 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 208 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 242 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 206 FRHIYRG 212 >gb|EXC30555.1| Auxin response factor 3 [Morus notabilis] Length = 750 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 217 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 251 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 215 FRHIYRG 221 >ref|XP_006364312.1| PREDICTED: auxin response factor 3-like isoform X1 [Solanum tuberosum] gi|565397463|ref|XP_006364313.1| PREDICTED: auxin response factor 3-like isoform X2 [Solanum tuberosum] gi|565397465|ref|XP_006364314.1| PREDICTED: auxin response factor 3-like isoform X3 [Solanum tuberosum] Length = 748 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 214 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 248 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 212 FRHIYRG 218 >ref|XP_007025521.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 4 [Theobroma cacao] gi|508780887|gb|EOY28143.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 4 [Theobroma cacao] Length = 748 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 211 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 245 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 209 FRHIYRG 215 >ref|XP_006467718.1| PREDICTED: auxin response factor 3-like isoform X1 [Citrus sinensis] Length = 747 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 213 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 247 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 211 FRHIYRG 217 >ref|XP_006364315.1| PREDICTED: auxin response factor 3-like isoform X4 [Solanum tuberosum] Length = 747 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 213 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 247 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 211 FRHIYRG 217 >ref|NP_001234316.1| auxin response factor 3 [Solanum lycopersicum] gi|85069277|gb|ABC69710.1| auxin response factor 3 [Solanum lycopersicum] Length = 747 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 214 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 248 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 212 FRHIYRG 218 >ref|XP_007025520.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 3 [Theobroma cacao] gi|508780886|gb|EOY28142.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 3 [Theobroma cacao] Length = 745 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 211 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 245 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 209 FRHIYRG 215 >ref|XP_006467719.1| PREDICTED: auxin response factor 3-like isoform X2 [Citrus sinensis] Length = 744 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 213 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 247 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 211 FRHIYRG 217 >ref|XP_007025518.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 1 [Theobroma cacao] gi|508780884|gb|EOY28140.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 1 [Theobroma cacao] Length = 744 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 211 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 245 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 209 FRHIYRG 215 >ref|XP_006449420.1| hypothetical protein CICLE_v10014391mg [Citrus clementina] gi|557552031|gb|ESR62660.1| hypothetical protein CICLE_v10014391mg [Citrus clementina] Length = 743 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 212 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 246 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 210 FRHIYRG 216 >ref|XP_006377428.1| hypothetical protein POPTR_0011s05830g [Populus trichocarpa] gi|550327718|gb|ERP55225.1| hypothetical protein POPTR_0011s05830g [Populus trichocarpa] Length = 740 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 208 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 242 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 206 FRHIYRG 212 >ref|XP_002273401.2| PREDICTED: auxin response factor 3-like [Vitis vinifera] Length = 740 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 209 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 243 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 207 FRHIYRG 213 >ref|XP_002440246.1| hypothetical protein SORBIDRAFT_09g028450 [Sorghum bicolor] gi|241945531|gb|EES18676.1| hypothetical protein SORBIDRAFT_09g028450 [Sorghum bicolor] Length = 739 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 225 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 259 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 223 FRHIYRG 229 >ref|XP_006597463.1| PREDICTED: auxin response factor 3-like [Glycine max] Length = 736 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 203 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 237 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 201 FRHIYRG 207 >gb|AFW79158.1| hypothetical protein ZEAMMB73_920641 [Zea mays] Length = 736 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 220 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 254 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 218 FRHIYRG 224 >ref|XP_003543018.1| PREDICTED: auxin response factor 3-like [Glycine max] Length = 736 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 133 YLCEGRPRRHLLTTGWTAFVNRKKLVSGDAVLFLR 237 ++ G+PRRHLLTTGW+AFVN+KKLVSGDAVLFLR Sbjct: 212 HIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 246 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FRHIYRG 22 FRHIYRG Sbjct: 210 FRHIYRG 216