BLASTX nr result
ID: Cocculus23_contig00053788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053788 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD00190.1| hypothetical protein BAUCODRAFT_102597 [Baudoinia... 56 6e-06 >gb|EMD00190.1| hypothetical protein BAUCODRAFT_102597 [Baudoinia compniacensis UAMH 10762] Length = 513 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +1 Query: 115 ITRSSTRLT-LNASRSFSASHHLNKRFRIDSLLGRHDAIKDVQVNAWIRSVRRQKRVTFV 291 ITR S +LT +N S +FS +R + LL KD +V W+RSVRRQK++ F Sbjct: 6 ITRYSKQLTPINYSCAFSTFSQCRERLNVSQLLSSGAEAKDAEVYGWVRSVRRQKKIAFA 65 Query: 292 ALGDG 306 A+GDG Sbjct: 66 AVGDG 70