BLASTX nr result
ID: Cocculus23_contig00053689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053689 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME79402.1| hypothetical protein MYCFIDRAFT_204808 [Pseudocer... 58 2e-06 >gb|EME79402.1| hypothetical protein MYCFIDRAFT_204808 [Pseudocercospora fijiensis CIRAD86] Length = 103 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/61 (49%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = +2 Query: 110 VVERTISTECCPKSKTSGCSACPPSGKCPQG-DDTYSSCSFNKQVGVIDLFVCNVLNGNS 286 + RT S CCPK K SGCS+C PS CP D Y+SC N+ G++ L C+VLNGN+ Sbjct: 38 IFARTGSGACCPKGKHSGCSSCEPSQSCPSDKPDKYTSC--NQIAGLVVL--CDVLNGNT 93 Query: 287 L 289 + Sbjct: 94 I 94