BLASTX nr result
ID: Cocculus23_contig00053637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053637 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME84895.1| hypothetical protein MYCFIDRAFT_211004 [Pseudocer... 59 5e-07 >gb|EME84895.1| hypothetical protein MYCFIDRAFT_211004 [Pseudocercospora fijiensis CIRAD86] Length = 199 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 10/65 (15%) Frame = +1 Query: 172 GRLIGWLWFSVIRGGKRGYARVALDDNN-----EQDKL-----DESVEPLPQYEEAPAYE 321 GRLIG+LW RGG+RGY V L+D++ E +K+ V+PLP YEEAPAYE Sbjct: 133 GRLIGFLWIKFYRGGRRGYQSVRLEDDDTRIEAENEKVIVIEDAPEVDPLPVYEEAPAYE 192 Query: 322 VTEKE 336 KE Sbjct: 193 EAAKE 197