BLASTX nr result
ID: Cocculus23_contig00052753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052753 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD61720.1| hypothetical protein COCSADRAFT_96837 [Bipolaris ... 177 1e-42 ref|XP_003856771.1| hypothetical protein MYCGRDRAFT_102943 [Zymo... 177 1e-42 gb|EWG37568.1| ADP-ribosylation factor [Fusarium verticillioides... 176 2e-42 ref|XP_381190.1| ARF_AJECA ADP-RIBOSYLATION FACTOR [Fusarium gra... 176 2e-42 gb|EPE27196.1| P-loop containing nucleoside triphosphate hydrola... 176 3e-42 gb|EME49550.1| hypothetical protein DOTSEDRAFT_143649 [Dothistro... 176 4e-42 ref|XP_007293765.1| ADP-ribosylation factor 1 [Marssonina brunne... 176 4e-42 ref|XP_001797240.1| hypothetical protein SNOG_06879 [Phaeosphaer... 176 4e-42 gb|EXJ85935.1| ADP-ribosylation factor [Capronia coronata CBS 61... 175 5e-42 gb|EXJ68077.1| ADP-ribosylation factor [Cladophialophora psammop... 175 5e-42 gb|ETI21958.1| ADP-ribosylation factor [Cladophialophora carrion... 175 5e-42 gb|EHY55497.1| ADP-ribosylation factor [Exophiala dermatitidis N... 175 5e-42 gb|EFZ00287.1| ADP-ribosylation factor 1 [Metarhizium anisopliae... 174 9e-42 gb|EQL01021.1| Small GTPase superfamily, ARF type [Ophiocordycep... 174 1e-41 gb|EPQ67144.1| ADP-ribosylation factor GTPase of the Ras superfa... 174 1e-41 gb|EOO02071.1| putative adp-ribosylation factor protein [Tognini... 174 1e-41 gb|EMR72354.1| putative adp-ribosylation factor protein [Eutypa ... 174 1e-41 ref|XP_006962569.1| ADP-ribosylation factor GTPase of the ras su... 174 1e-41 ref|XP_003005221.1| ADP-ribosylation factor [Verticillium alfalf... 174 1e-41 ref|XP_003713533.1| ADP-ribosylation factor [Magnaporthe oryzae ... 174 1e-41 >gb|EMD61720.1| hypothetical protein COCSADRAFT_96837 [Bipolaris sorokiniana ND90Pr] gi|451998936|gb|EMD91399.1| hypothetical protein COCHEDRAFT_1135886 [Bipolaris maydis C5] gi|477591772|gb|ENI08844.1| hypothetical protein COCC4DRAFT_129356 [Bipolaris maydis ATCC 48331] gi|482804815|gb|EOA81914.1| hypothetical protein SETTUDRAFT_23174 [Setosphaeria turcica Et28A] gi|576918708|gb|EUC32898.1| hypothetical protein COCCADRAFT_97497 [Bipolaris zeicola 26-R-13] gi|576927733|gb|EUC41405.1| hypothetical protein COCMIDRAFT_106246 [Bipolaris oryzae ATCC 44560] gi|578490700|gb|EUN28113.1| hypothetical protein COCVIDRAFT_96243 [Bipolaris victoriae FI3] Length = 183 Score = 177 bits (450), Expect = 1e-42 Identities = 87/90 (96%), Positives = 88/90 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWL+NSLR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGHQ 183 >ref|XP_003856771.1| hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] gi|339476656|gb|EGP91747.1| hypothetical protein MYCGRDRAFT_102943 [Zymoseptoria tritici IPO323] Length = 183 Score = 177 bits (450), Expect = 1e-42 Identities = 87/90 (96%), Positives = 88/90 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWL+NSLR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGHQ 183 >gb|EWG37568.1| ADP-ribosylation factor [Fusarium verticillioides 7600] Length = 142 Score = 176 bits (447), Expect = 2e-42 Identities = 85/90 (94%), Positives = 88/90 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 53 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 112 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLAN+LR AGHQ Sbjct: 113 YIQSTCATSGDGLYEGLEWLANTLRKAGHQ 142 >ref|XP_381190.1| ARF_AJECA ADP-RIBOSYLATION FACTOR [Fusarium graminearum PH-1] gi|302926122|ref|XP_003054231.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256735172|gb|EEU48518.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342887872|gb|EGU87300.1| hypothetical protein FOXB_02176 [Fusarium oxysporum Fo5176] gi|408391865|gb|EKJ71232.1| hypothetical protein FPSE_08595 [Fusarium pseudograminearum CS3096] gi|475664297|gb|EMT62092.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 4] gi|477507571|gb|ENH60865.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense race 1] gi|517310870|emb|CCT62268.1| probable ADP-ribosylation factor [Fusarium fujikuroi IMI 58289] gi|558856199|gb|ESU06282.1| hypothetical protein FGSG_01014 [Fusarium graminearum PH-1] gi|584128146|gb|EWG37565.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|584128147|gb|EWG37566.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|584128148|gb|EWG37567.1| ADP-ribosylation factor [Fusarium verticillioides 7600] gi|587671742|gb|EWY94083.1| ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] gi|587671743|gb|EWY94084.1| ADP-ribosylation factor [Fusarium oxysporum FOSC 3-a] gi|587704019|gb|EWZ50624.1| ADP-ribosylation factor [Fusarium oxysporum Fo47] gi|587704020|gb|EWZ50625.1| ADP-ribosylation factor [Fusarium oxysporum Fo47] gi|587720577|gb|EWZ91914.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755456|gb|EXA53172.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] gi|587755457|gb|EXA53173.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. pisi HDV247] gi|590046002|gb|EXK47860.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] gi|590046003|gb|EXK47861.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. melonis 26406] gi|590062216|gb|EXK89740.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] gi|590062217|gb|EXK89741.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. raphani 54005] gi|591414407|gb|EXL49544.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591414408|gb|EXL49545.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591448359|gb|EXL80769.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591448360|gb|EXL80770.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479967|gb|EXM11027.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591479968|gb|EXM11028.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591494735|gb|EXM24283.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591494736|gb|EXM24284.1| ADP-ribosylation factor [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596554618|gb|EYB33707.1| hypothetical protein FG05_01014 [Fusarium graminearum] Length = 183 Score = 176 bits (447), Expect = 2e-42 Identities = 85/90 (94%), Positives = 88/90 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLAN+LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLANTLRKAGHQ 183 >gb|EPE27196.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] Length = 183 Score = 176 bits (446), Expect = 3e-42 Identities = 86/90 (95%), Positives = 88/90 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA+SLR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLASSLRKAGHQ 183 >gb|EME49550.1| hypothetical protein DOTSEDRAFT_143649 [Dothistroma septosporum NZE10] gi|452989650|gb|EME89405.1| hypothetical protein MYCFIDRAFT_49010 [Pseudocercospora fijiensis CIRAD86] gi|453089149|gb|EMF17189.1| ARF/SAR superfamily [Sphaerulina musiva SO2202] Length = 183 Score = 176 bits (445), Expect = 4e-42 Identities = 86/89 (96%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >ref|XP_007293765.1| ADP-ribosylation factor 1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862816|gb|EKD15865.1| ADP-ribosylation factor 1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 183 Score = 176 bits (445), Expect = 4e-42 Identities = 86/90 (95%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA SLR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLAQSLRKAGHQ 183 >ref|XP_001797240.1| hypothetical protein SNOG_06879 [Phaeosphaeria nodorum SN15] gi|189189756|ref|XP_001931217.1| ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330941983|ref|XP_003306107.1| hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] gi|396462996|ref|XP_003836109.1| similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] gi|615420276|ref|XP_007586441.1| putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] gi|111064410|gb|EAT85530.1| hypothetical protein SNOG_06879 [Phaeosphaeria nodorum SN15] gi|187972823|gb|EDU40322.1| ADP-ribosylation factor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316547|gb|EFQ85784.1| hypothetical protein PTT_19141 [Pyrenophora teres f. teres 0-1] gi|312212661|emb|CBX92744.1| similar to ADP-ribosylation factor [Leptosphaeria maculans JN3] gi|407918010|gb|EKG11308.1| Ras small GTPase Rab type [Macrophomina phaseolina MS6] gi|485919893|gb|EOD46072.1| putative adp-ribosylation factor protein [Neofusicoccum parvum UCRNP2] gi|494830941|gb|EON67452.1| ADP-ribosylation factor [Coniosporium apollinis CBS 100218] Length = 183 Score = 176 bits (445), Expect = 4e-42 Identities = 86/89 (96%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >gb|EXJ85935.1| ADP-ribosylation factor [Capronia coronata CBS 617.96] Length = 183 Score = 175 bits (444), Expect = 5e-42 Identities = 85/89 (95%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >gb|EXJ68077.1| ADP-ribosylation factor [Cladophialophora psammophila CBS 110553] Length = 183 Score = 175 bits (444), Expect = 5e-42 Identities = 85/89 (95%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >gb|ETI21958.1| ADP-ribosylation factor [Cladophialophora carrionii CBS 160.54] gi|589975777|gb|EXJ59078.1| ADP-ribosylation factor [Cladophialophora yegresii CBS 114405] Length = 183 Score = 175 bits (444), Expect = 5e-42 Identities = 85/89 (95%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >gb|EHY55497.1| ADP-ribosylation factor [Exophiala dermatitidis NIH/UT8656] gi|449305234|gb|EMD01241.1| hypothetical protein BAUCODRAFT_61772 [Baudoinia compniacensis UAMH 10762] gi|568123743|gb|ETN46328.1| ADP-ribosylation factor [Cyphellophora europaea CBS 101466] gi|590009812|gb|EXJ85018.1| ADP-ribosylation factor [Capronia epimyces CBS 606.96] Length = 183 Score = 175 bits (444), Expect = 5e-42 Identities = 85/89 (95%), Positives = 87/89 (97%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGH 21 YIQSTCATSGDGLYEGLEWL+NSLR AGH Sbjct: 154 YIQSTCATSGDGLYEGLEWLSNSLRKAGH 182 >gb|EFZ00287.1| ADP-ribosylation factor 1 [Metarhizium anisopliae ARSEF 23] gi|594719863|gb|EXV02752.1| Ras GTPase family protein [Metarhizium robertsii] Length = 183 Score = 174 bits (442), Expect = 9e-42 Identities = 85/90 (94%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 183 >gb|EQL01021.1| Small GTPase superfamily, ARF type [Ophiocordyceps sinensis CO18] Length = 187 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 98 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 157 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 158 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 187 >gb|EPQ67144.1| ADP-ribosylation factor GTPase of the Ras superfamily [Blumeria graminis f. sp. tritici 96224] gi|528289891|emb|CCU82822.1| ADP-ribosylation factor [Blumeria graminis f. sp. hordei DH14] Length = 183 Score = 174 bits (441), Expect = 1e-41 Identities = 85/90 (94%), Positives = 86/90 (95%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDRVVEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLH LRQR W Sbjct: 94 SNDRDRVVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHGLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA SLR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLAQSLRKAGHQ 183 >gb|EOO02071.1| putative adp-ribosylation factor protein [Togninia minima UCRPA7] Length = 183 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 183 >gb|EMR72354.1| putative adp-ribosylation factor protein [Eutypa lata UCREL1] Length = 183 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 183 >ref|XP_006962569.1| ADP-ribosylation factor GTPase of the ras superfamily [Trichoderma reesei QM6a] gi|596726330|ref|XP_007287254.1| ADP-ribosylation factor [Colletotrichum gloeosporioides Nara gc5] gi|615469462|ref|XP_007600554.1| ADP-ribosylation factor [Colletotrichum fioriniae PJ7] gi|310790948|gb|EFQ26481.1| ADP-ribosylation factor family protein [Colletotrichum graminicola M1.001] gi|340520996|gb|EGR51231.1| ADP-ribosylation factor GTPase of the ras superfamily [Trichoderma reesei QM6a] gi|346979477|gb|EGY22929.1| ADP-ribosylation factor [Verticillium dahliae VdLs.17] gi|358379833|gb|EHK17512.1| hypothetical protein TRIVIDRAFT_111493 [Trichoderma virens Gv29-8] gi|358400654|gb|EHK49980.1| hypothetical protein TRIATDRAFT_297344 [Trichoderma atroviride IMI 206040] gi|380472300|emb|CCF46842.1| ADP-ribosylation factor [Colletotrichum higginsianum] gi|399165063|emb|CCE34068.1| probable ADP-ribosylation factor [Claviceps purpurea 20.1] gi|429848186|gb|ELA23700.1| ADP-ribosylation factor [Colletotrichum gloeosporioides Nara gc5] gi|477537030|gb|ENH88490.1| ADP-ribosylation factor [Colletotrichum orbiculare MAFF 240422] gi|530469312|gb|EQB50492.1| hypothetical protein CGLO_10064 [Colletotrichum gloeosporioides Cg-14] gi|572281408|gb|ETS04432.1| ADP-ribosylation factor family protein [Trichoderma reesei RUT C-30] gi|588893699|gb|EXF75787.1| ADP-ribosylation factor [Colletotrichum fioriniae PJ7] Length = 183 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 183 >ref|XP_003005221.1| ADP-ribosylation factor [Verticillium alfalfae VaMs.102] gi|261356290|gb|EEY18718.1| ADP-ribosylation factor [Verticillium alfalfae VaMs.102] Length = 180 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 91 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 150 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 151 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 180 >ref|XP_003713533.1| ADP-ribosylation factor [Magnaporthe oryzae 70-15] gi|351645866|gb|EHA53726.1| ADP-ribosylation factor [Magnaporthe oryzae 70-15] gi|440465557|gb|ELQ34876.1| ADP-ribosylation factor 1 [Magnaporthe oryzae Y34] gi|440478549|gb|ELQ59368.1| ADP-ribosylation factor 1 [Magnaporthe oryzae P131] Length = 183 Score = 174 bits (441), Expect = 1e-41 Identities = 84/90 (93%), Positives = 87/90 (96%) Frame = -1 Query: 287 SNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQW 108 SNDRDR+VEAREELQRMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR W Sbjct: 94 SNDRDRIVEAREELQRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRAW 153 Query: 107 YIQSTCATSGDGLYEGLEWLANSLRNAGHQ 18 YIQSTCATSGDGLYEGLEWLA +LR AGHQ Sbjct: 154 YIQSTCATSGDGLYEGLEWLATTLRKAGHQ 183