BLASTX nr result
ID: Cocculus23_contig00052429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052429 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 83 5e-14 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 81 1e-13 gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia... 79 5e-13 gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W1... 79 7e-13 gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphae... 79 9e-13 ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria trit... 78 1e-12 ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 78 1e-12 gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyen... 78 1e-12 emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria ma... 78 1e-12 ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fucke... 78 1e-12 ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR... 78 1e-12 emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roqueforti] 77 2e-12 gb|EME86182.1| hypothetical protein MYCFIDRAFT_9987, partial [Ps... 77 3e-12 gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolari... 77 3e-12 ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 77 3e-12 gb|ETN42172.1| 40S ribosomal protein S29 [Cyphellophora europaea... 76 4e-12 gb|EPQ65083.1| Protein component of the small (40S) ribosomal su... 76 4e-12 gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carri... 76 6e-12 gb|EMR66868.1| putative 40s ribosomal protein s29 protein [Eutyp... 76 6e-12 ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunne... 76 6e-12 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREKS+DIGFTKHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH+AGLIRKYGLNICRQCFREKS DIGFTKHR Sbjct: 21 CRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREKSTDIGF KHR Sbjct: 21 CRVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria tritici IPO323] gi|339475249|gb|EGP90341.1| hypothetical protein MYCGRDRAFT_103406 [Zymoseptoria tritici IPO323] Length = 56 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH+AGLIRKYGLNICRQCFREK+ DIGFTKHR Sbjct: 21 CRVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREK++DIGF KHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] Length = 56 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria macrospora k-hell] Length = 56 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREK+ DIGFTKHR Sbjct: 21 CRVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fuckeliana B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botryotinia fuckeliana T4] Length = 56 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|30316288|sp|Q9C2P2.1|RS29_NEUCR RecName: Full=40S ribosomal protein S29 gi|12718270|emb|CAC28832.1| probable ribosomal protein S29.e.A, cytosolic [Neurospora crassa] gi|28923060|gb|EAA32278.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|336473030|gb|EGO61190.1| hypothetical protein NEUTE1DRAFT_135165 [Neurospora tetrasperma FGSC 2508] gi|350293719|gb|EGZ74804.1| putative ribosomal protein S29.e.A, cytosolic [Neurospora tetrasperma FGSC 2509] Length = 56 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREK+ DIGFTKHR Sbjct: 21 CRVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roqueforti] Length = 56 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVC+H+AGLIRKYG+NICRQCFREKSTDIGFTK+R Sbjct: 21 CRVCSHRAGLIRKYGMNICRQCFREKSTDIGFTKYR 56 >gb|EME86182.1| hypothetical protein MYCFIDRAFT_9987, partial [Pseudocercospora fijiensis CIRAD86] Length = 56 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREKS DIGFTK R Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSNDIGFTKVR 56 >gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 21 CRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 83 CRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 118 >gb|ETN42172.1| 40S ribosomal protein S29 [Cyphellophora europaea CBS 101466] Length = 66 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGF K R Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKVR 56 >gb|EPQ65083.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528300960|emb|CCU75163.1| 40S ribosomal protein S29 [Blumeria graminis f. sp. hordei DH14] Length = 56 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGL+ICRQCFREK++DIGF KHR Sbjct: 21 CRVCTHKAGLIRKYGLDICRQCFREKASDIGFVKHR 56 >gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTH AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 21 CRVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >gb|EMR66868.1| putative 40s ribosomal protein s29 protein [Eutypa lata UCREL1] Length = 83 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTK 104 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGF K Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFVK 54 >ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866814|gb|EKD19853.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 130 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 CRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 110 CRVCTHKAGLIRKYGLNICRQCFREK+ DIGF KH+ Sbjct: 21 CRVCTHKAGLIRKYGLNICRQCFREKAHDIGFVKHK 56