BLASTX nr result
ID: Cocculus23_contig00052357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052357 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31207.1| DNA ligase 4 [Morus notabilis] 56 6e-06 >gb|EXC31207.1| DNA ligase 4 [Morus notabilis] Length = 627 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = +2 Query: 5 PRNTT*WVLGRRKVRNRCIDLIKEIYNNVITIIKSMVGKTTKFPITLGLHQNKLM 169 PR WVL +R VR R I +IK++Y+ V+T ++++ G TT+FPI +GLHQ + Sbjct: 559 PREVLWWVLEKRGVRVRYIKVIKDMYDGVVTSVRTVGGYTTEFPIRIGLHQRSAL 613