BLASTX nr result
ID: Cocculus23_contig00052322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052322 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME38509.1| hypothetical protein DOTSEDRAFT_75887 [Dothistrom... 56 5e-06 ref|XP_003847963.1| hypothetical protein MYCGRDRAFT_111502 [Zymo... 55 8e-06 >gb|EME38509.1| hypothetical protein DOTSEDRAFT_75887 [Dothistroma septosporum NZE10] Length = 142 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 137 MDCFHDFCLACDKQCTDGPYCSQTCRLVDL 226 MDCF DFCL CD++ DGPYCSQ C+L DL Sbjct: 1 MDCFQDFCLFCDRESLDGPYCSQQCKLADL 30 >ref|XP_003847963.1| hypothetical protein MYCGRDRAFT_111502 [Zymoseptoria tritici IPO323] gi|339467837|gb|EGP82939.1| hypothetical protein MYCGRDRAFT_111502 [Zymoseptoria tritici IPO323] Length = 163 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 137 MDCFHDFCLACDKQCTDGPYCSQTCRLVDL 226 MDCF DFCL CD+ DGPYCSQ C+L DL Sbjct: 1 MDCFQDFCLFCDRDSPDGPYCSQRCKLADL 30