BLASTX nr result
ID: Cocculus23_contig00052253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052253 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212687.1| hypothetical protein PRUPE_ppa018493mg [Prun... 56 5e-06 >ref|XP_007212687.1| hypothetical protein PRUPE_ppa018493mg [Prunus persica] gi|462408552|gb|EMJ13886.1| hypothetical protein PRUPE_ppa018493mg [Prunus persica] Length = 496 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 97 MAESQKVAASTCKSLKNNLLPDEEIGKEFLSSWKSMTMMEDD 222 MAES+K +S+ + + LPDEEIG EFLSSWKSM++MEDD Sbjct: 1 MAESKKAISSSVNPKEKSSLPDEEIGNEFLSSWKSMSVMEDD 42