BLASTX nr result
ID: Cocculus23_contig00052183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052183 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006393851.1| hypothetical protein EUTSA_v10003788mg [Eutr... 83 5e-14 ref|XP_002866755.1| phototropic-responsive NPH3 family protein [... 83 5e-14 gb|EYU44328.1| hypothetical protein MIMGU_mgv1a002439mg [Mimulus... 82 6e-14 ref|XP_004301873.1| PREDICTED: BTB/POZ domain-containing protein... 82 8e-14 ref|NP_201457.1| phototropic-responsive NPH3 family protein [Ara... 82 1e-13 dbj|BAB10932.1| photoreceptor-interacting protein-like [Arabidop... 82 1e-13 gb|AAK83642.1| AT5g66560/K1F13_23 [Arabidopsis thaliana] gi|2411... 82 1e-13 ref|XP_002310186.2| hypothetical protein POPTR_0007s12050g [Popu... 80 2e-13 ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prun... 80 2e-13 emb|CBI38361.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002272552.1| PREDICTED: BTB/POZ domain-containing protein... 80 3e-13 emb|CAN61829.1| hypothetical protein VITISV_027631 [Vitis vinifera] 80 3e-13 ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phas... 79 5e-13 ref|XP_004509199.1| PREDICTED: BTB/POZ domain-containing protein... 79 5e-13 ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein... 79 5e-13 ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein... 79 5e-13 ref|XP_003636081.1| Root phototropism protein [Medicago truncatu... 79 5e-13 ref|XP_002307235.2| phototropic-responsive NPH3 family protein [... 78 1e-12 ref|XP_007047096.1| Phototropic-responsive NPH3 family protein i... 78 1e-12 ref|XP_002522384.1| protein binding protein, putative [Ricinus c... 78 1e-12 >ref|XP_006393851.1| hypothetical protein EUTSA_v10003788mg [Eutrema salsugineum] gi|557090490|gb|ESQ31137.1| hypothetical protein EUTSA_v10003788mg [Eutrema salsugineum] Length = 653 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MASEKSSSKGQAWFCTTGLPSDI +E++DM+FHLHKFPLM+K Sbjct: 1 MASEKSSSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSK 42 >ref|XP_002866755.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297312590|gb|EFH43014.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata subsp. lyrata] Length = 630 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MASEKSSSKGQAWFCTTGLPSDI +E++DM+FHLHKFPLM+K Sbjct: 1 MASEKSSSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSK 42 >gb|EYU44328.1| hypothetical protein MIMGU_mgv1a002439mg [Mimulus guttatus] Length = 675 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = +2 Query: 404 EPKIMASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 E + MA+EK SSKGQAWFCTTGLPSD+++E++DM+FHLHKFPLM+K Sbjct: 2 EERKMAAEKPSSKGQAWFCTTGLPSDVIIEVDDMTFHLHKFPLMSK 47 >ref|XP_004301873.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Fragaria vesca subsp. vesca] Length = 671 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 A+EKSSSKGQAWFCTTGLPSDIVVE+ DM+FHLHKFPLM+K Sbjct: 6 AAEKSSSKGQAWFCTTGLPSDIVVEVEDMTFHLHKFPLMSK 46 >ref|NP_201457.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] gi|338819810|sp|Q94A73.2|Y5656_ARATH RecName: Full=BTB/POZ domain-containing protein At5g66560 gi|332010846|gb|AED98229.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] Length = 668 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MASEKS+SKGQAWFCTTGLPSDI +E++DM+FHLHKFPLM+K Sbjct: 1 MASEKSTSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSK 42 >dbj|BAB10932.1| photoreceptor-interacting protein-like [Arabidopsis thaliana] Length = 597 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MASEKS+SKGQAWFCTTGLPSDI +E++DM+FHLHKFPLM+K Sbjct: 1 MASEKSTSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSK 42 >gb|AAK83642.1| AT5g66560/K1F13_23 [Arabidopsis thaliana] gi|24111403|gb|AAN46836.1| At5g66560/K1F13_23 [Arabidopsis thaliana] Length = 668 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MASEKS+SKGQAWFCTTGLPSDI +E++DM+FHLHKFPLM+K Sbjct: 1 MASEKSTSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSK 42 >ref|XP_002310186.2| hypothetical protein POPTR_0007s12050g [Populus trichocarpa] gi|550334708|gb|EEE90636.2| hypothetical protein POPTR_0007s12050g [Populus trichocarpa] Length = 715 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = +2 Query: 362 PSFSRRSVFAH*DSEPKIMASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 PS ++ VF MA+EK SKGQAWFCTTGLPSDIV+E+ DM+FHLHKFPLM+K Sbjct: 48 PSHKKQQVFLK-----TKMAAEKPGSKGQAWFCTTGLPSDIVIEVGDMTFHLHKFPLMSK 102 >ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] gi|462399384|gb|EMJ05052.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] Length = 684 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 A+EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 7 AAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 47 >emb|CBI38361.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MA+EK+S +GQAWFCTTGLPSDIV+E++DM+FHLHKFPLM+K Sbjct: 1 MAAEKASGRGQAWFCTTGLPSDIVIEVDDMTFHLHKFPLMSK 42 >ref|XP_002272552.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Vitis vinifera] Length = 635 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MA+EK+S +GQAWFCTTGLPSDIV+E++DM+FHLHKFPLM+K Sbjct: 1 MAAEKASGRGQAWFCTTGLPSDIVIEVDDMTFHLHKFPLMSK 42 >emb|CAN61829.1| hypothetical protein VITISV_027631 [Vitis vinifera] Length = 723 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MA+EK+S +GQAWFCTTGLPSDIV+E++DM+FHLHKFPLM+K Sbjct: 1 MAAEKASGRGQAWFCTTGLPSDIVIEVDDMTFHLHKFPLMSK 42 >ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|593785903|ref|XP_007155992.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029345|gb|ESW27985.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029346|gb|ESW27986.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] Length = 649 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 ++EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_004509199.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Cicer arietinum] Length = 646 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 ++EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] Length = 648 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 ++EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] Length = 655 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 ++EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_003636081.1| Root phototropism protein [Medicago truncatula] gi|355502016|gb|AES83219.1| Root phototropism protein [Medicago truncatula] Length = 661 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 419 ASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 ++EK SSKGQAWFCTTGLPSDIVVE++DM+FHLHKFPLM+K Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_002307235.2| phototropic-responsive NPH3 family protein [Populus trichocarpa] gi|550338879|gb|EEE94231.2| phototropic-responsive NPH3 family protein [Populus trichocarpa] Length = 627 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 MA+EK SSKGQAWFCTTGLPSDIV+E+ DM+FHLHKFPL ++ Sbjct: 1 MAAEKPSSKGQAWFCTTGLPSDIVIEVEDMTFHLHKFPLTSR 42 >ref|XP_007047096.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] gi|508699357|gb|EOX91253.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] Length = 778 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = +2 Query: 398 DSEPKIMASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 D + MA++K SSKGQAWFC TGLPSDI++E++DM+FHLHKFPLM+K Sbjct: 94 DFNKEKMAADKPSSKGQAWFCATGLPSDIMIEVDDMTFHLHKFPLMSK 141 >ref|XP_002522384.1| protein binding protein, putative [Ricinus communis] gi|223538462|gb|EEF40068.1| protein binding protein, putative [Ricinus communis] Length = 646 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +2 Query: 416 MASEKSSSKGQAWFCTTGLPSDIVVEINDMSFHLHKFPLMAK 541 M +EK SS+GQAWFCTTGLPSDI++E+ DM+FHLHKFPLM+K Sbjct: 1 METEKPSSRGQAWFCTTGLPSDIIIEVEDMTFHLHKFPLMSK 42