BLASTX nr result
ID: Cocculus23_contig00052072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052072 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853842.1| hypothetical protein MYCGRDRAFT_108627 [Zymo... 117 1e-24 gb|EME45838.1| hypothetical protein DOTSEDRAFT_71512 [Dothistrom... 117 2e-24 gb|EMF13312.1| eIF-5_eIF-2B-domain-containing protein [Sphaeruli... 113 3e-23 gb|EME84060.1| hypothetical protein MYCFIDRAFT_152337 [Pseudocer... 108 8e-22 ref|XP_002846695.1| eukaryotic translation initiation factor 5 [... 105 5e-21 ref|XP_003174667.1| eukaryotic translation initiation factor 5 [... 105 7e-21 gb|EGC41741.1| eukaryotic translation initiation factor 5 [Ajell... 103 3e-20 gb|EER45796.1| eukaryotic translation initiation factor 5 [Ajell... 103 3e-20 gb|EEH07643.1| eukaryotic translation initiation factor 5 [Ajell... 103 3e-20 ref|XP_001537881.1| eukaryotic translation initiation factor 5 [... 103 3e-20 gb|EMD85698.1| hypothetical protein COCHEDRAFT_1035241 [Bipolari... 103 3e-20 gb|EMD63396.1| hypothetical protein COCSADRAFT_327307 [Bipolaris... 103 3e-20 gb|EEH49279.1| eukaryotic translation initiation factor 5 [Parac... 103 3e-20 ref|XP_002795514.1| eukaryotic translation initiation factor 5 [... 103 3e-20 gb|EEH22524.1| eukaryotic translation initiation factor 5 [Parac... 103 3e-20 gb|EZF16293.1| hypothetical protein H100_05755 [Trichophyton rub... 101 1e-19 gb|EUC41222.1| hypothetical protein COCMIDRAFT_9048 [Bipolaris o... 101 1e-19 gb|EUC31435.1| hypothetical protein COCCADRAFT_101281 [Bipolaris... 101 1e-19 gb|EGD93608.1| eukaryotic translation initiation factor 5 [Trich... 101 1e-19 ref|XP_003236408.1| eukaryotic translation initiation factor 5 [... 101 1e-19 >ref|XP_003853842.1| hypothetical protein MYCGRDRAFT_108627 [Zymoseptoria tritici IPO323] gi|339473725|gb|EGP88818.1| hypothetical protein MYCGRDRAFT_108627 [Zymoseptoria tritici IPO323] Length = 427 Score = 117 bits (294), Expect = 1e-24 Identities = 55/73 (75%), Positives = 66/73 (90%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGIDKP+LIP VSA+LL+++ +DLVSEE+L W G+ASKKYVDI+TSRKVR Sbjct: 344 AFLGGIERFVGIDKPNLIPMVSAILLKVYENDLVSEEILTAWGGKASKKYVDISTSRKVR 403 Query: 181 KSAEKFLSWLKEA 219 KSAEKF+ WL+ A Sbjct: 404 KSAEKFIEWLETA 416 >gb|EME45838.1| hypothetical protein DOTSEDRAFT_71512 [Dothistroma septosporum NZE10] Length = 428 Score = 117 bits (292), Expect = 2e-24 Identities = 57/73 (78%), Positives = 65/73 (89%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ERFVGIDKP+LIP+VSAVLL+I+ +DLVSEE L W G+ASKKYVDIATSRKVR Sbjct: 346 AFLGGFERFVGIDKPNLIPTVSAVLLKIYENDLVSEEQLKAWGGKASKKYVDIATSRKVR 405 Query: 181 KSAEKFLSWLKEA 219 KSAEKF+ WL+ A Sbjct: 406 KSAEKFIEWLENA 418 >gb|EMF13312.1| eIF-5_eIF-2B-domain-containing protein [Sphaerulina musiva SO2202] Length = 418 Score = 113 bits (282), Expect = 3e-23 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGIDKP+LIPSVSA+LL+++ +DL +EE L W G+ASKKYVD+ TSRKVR Sbjct: 336 AFLGGIERFVGIDKPNLIPSVSAILLKVYENDLATEENLKAWCGKASKKYVDLQTSRKVR 395 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 396 KSAEKFLEWLENA 408 >gb|EME84060.1| hypothetical protein MYCFIDRAFT_152337 [Pseudocercospora fijiensis CIRAD86] Length = 422 Score = 108 bits (270), Expect = 8e-22 Identities = 54/73 (73%), Positives = 62/73 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVG DKP+LIPSVSA+LL+I+ DLVSEEVL W +ASKK+VDI TS+KVR Sbjct: 340 AFLGGIERFVGNDKPNLIPSVSAILLKIYEDDLVSEEVLKAWCTKASKKHVDIQTSKKVR 399 Query: 181 KSAEKFLSWLKEA 219 KSAEKF WL+ A Sbjct: 400 KSAEKFAEWLENA 412 >ref|XP_002846695.1| eukaryotic translation initiation factor 5 [Arthroderma otae CBS 113480] gi|238841951|gb|EEQ31613.1| eukaryotic translation initiation factor 5 [Arthroderma otae CBS 113480] Length = 431 Score = 105 bits (263), Expect = 5e-21 Identities = 51/73 (69%), Positives = 62/73 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ERFVG D+P+L+P VS++LL + +DLVSEE+L +W +ASKKYVDIATSRKVR Sbjct: 348 AFLGGTERFVGKDRPNLLPMVSSILLTYYQNDLVSEELLKSWGTKASKKYVDIATSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 408 KSAEKFLQWLETA 420 >ref|XP_003174667.1| eukaryotic translation initiation factor 5 [Arthroderma gypseum CBS 118893] gi|311339982|gb|EFQ99184.1| eukaryotic translation initiation factor 5 [Arthroderma gypseum CBS 118893] Length = 431 Score = 105 bits (262), Expect = 7e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ERFVG D+P+L+P VS++LL + DLVSEE+L +W +ASKKYVDIATSRKVR Sbjct: 348 AFLGGTERFVGKDRPNLLPVVSSILLAYYQHDLVSEELLKSWGSKASKKYVDIATSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 408 KSAEKFLEWLETA 420 >gb|EGC41741.1| eukaryotic translation initiation factor 5 [Ajellomyces capsulatus H88] Length = 429 Score = 103 bits (257), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+L PSV A+LL + DL+SEEVL W +ASKKYVDIATSRKVR Sbjct: 348 AFLGGTERLVGIERPNLCPSVPAILLAYYQEDLISEEVLKAWGSKASKKYVDIATSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 K+AEKF+ WL+ A Sbjct: 408 KAAEKFIEWLETA 420 >gb|EER45796.1| eukaryotic translation initiation factor 5 [Ajellomyces capsulatus H143] Length = 312 Score = 103 bits (257), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+L PSV A+LL + DL+SEEVL W +ASKKYVDIATSRKVR Sbjct: 231 AFLGGTERLVGIERPNLCPSVPAILLAYYQEDLISEEVLKAWGSKASKKYVDIATSRKVR 290 Query: 181 KSAEKFLSWLKEA 219 K+AEKF+ WL+ A Sbjct: 291 KAAEKFIEWLETA 303 >gb|EEH07643.1| eukaryotic translation initiation factor 5 [Ajellomyces capsulatus G186AR] Length = 429 Score = 103 bits (257), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+L PSV A+LL + DL+SEEVL W +ASKKYVDIATSRKVR Sbjct: 348 AFLGGTERLVGIERPNLCPSVPAILLAYYQEDLISEEVLKAWGSKASKKYVDIATSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 K+AEKF+ WL+ A Sbjct: 408 KAAEKFIEWLETA 420 >ref|XP_001537881.1| eukaryotic translation initiation factor 5 [Ajellomyces capsulatus NAm1] gi|150415489|gb|EDN10842.1| eukaryotic translation initiation factor 5 [Ajellomyces capsulatus NAm1] Length = 387 Score = 103 bits (257), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+L PSV A+LL + DL+SEEVL W +ASKKYVDIATSRKVR Sbjct: 306 AFLGGTERLVGIERPNLCPSVPAILLAYYQEDLISEEVLKAWGSKASKKYVDIATSRKVR 365 Query: 181 KSAEKFLSWLKEA 219 K+AEKF+ WL+ A Sbjct: 366 KAAEKFIEWLETA 378 >gb|EMD85698.1| hypothetical protein COCHEDRAFT_1035241 [Bipolaris maydis C5] gi|477582460|gb|ENH99568.1| hypothetical protein COCC4DRAFT_152954 [Bipolaris maydis ATCC 48331] Length = 415 Score = 103 bits (256), Expect = 3e-20 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGIDKP LIP VSA+LL+++ +DLVSEE L TW +ASK+YVD+ S+ VR Sbjct: 335 AFLGGIERFVGIDKPELIPQVSAILLKVYENDLVSEEQLQTWCSKASKRYVDLKVSKTVR 394 Query: 181 KSAEKFLSWLKE 216 KSAE+F +WL++ Sbjct: 395 KSAEQFKNWLEQ 406 >gb|EMD63396.1| hypothetical protein COCSADRAFT_327307 [Bipolaris sorokiniana ND90Pr] Length = 415 Score = 103 bits (256), Expect = 3e-20 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGIDKP LIP VSA+LL+++ +DLVSEE L TW +ASK+YVD+ S+ VR Sbjct: 335 AFLGGIERFVGIDKPELIPQVSAILLKVYENDLVSEEQLQTWCSKASKRYVDLKVSKTVR 394 Query: 181 KSAEKFLSWLKE 216 KSAE+F +WL++ Sbjct: 395 KSAEQFKNWLEQ 406 >gb|EEH49279.1| eukaryotic translation initiation factor 5 [Paracoccidioides brasiliensis Pb18] Length = 429 Score = 103 bits (256), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+LIP V A+LL + DL+SEEVL W +ASKKYVDI+TSRKVR Sbjct: 348 AFLGGTERLVGIERPNLIPMVPAILLAYYQEDLISEEVLKAWGSKASKKYVDISTSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 K+AEKFL WL+ A Sbjct: 408 KAAEKFLQWLETA 420 >ref|XP_002795514.1| eukaryotic translation initiation factor 5 [Paracoccidioides sp. 'lutzii' Pb01] gi|226284599|gb|EEH40165.1| eukaryotic translation initiation factor 5 [Paracoccidioides sp. 'lutzii' Pb01] Length = 431 Score = 103 bits (256), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+LIP V A+LL + DL+SEEVL W +ASKKYVDI+TSRKVR Sbjct: 348 AFLGGTERLVGIERPNLIPMVPAILLAYYQEDLISEEVLKAWGSKASKKYVDISTSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 K+AEKFL WL+ A Sbjct: 408 KAAEKFLQWLETA 420 >gb|EEH22524.1| eukaryotic translation initiation factor 5 [Paracoccidioides brasiliensis Pb03] Length = 429 Score = 103 bits (256), Expect = 3e-20 Identities = 49/73 (67%), Positives = 59/73 (80%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGG ER VGI++P+LIP V A+LL + DL+SEEVL W +ASKKYVDI+TSRKVR Sbjct: 348 AFLGGTERLVGIERPNLIPMVPAILLAYYQEDLISEEVLKAWGSKASKKYVDISTSRKVR 407 Query: 181 KSAEKFLSWLKEA 219 K+AEKFL WL+ A Sbjct: 408 KAAEKFLQWLETA 420 >gb|EZF16293.1| hypothetical protein H100_05755 [Trichophyton rubrum MR850] gi|607902885|gb|EZF40429.1| hypothetical protein H102_05723 [Trichophyton rubrum CBS 100081] gi|607914867|gb|EZF50937.1| hypothetical protein H103_05751 [Trichophyton rubrum CBS 288.86] gi|607927019|gb|EZF61652.1| hypothetical protein H104_05735 [Trichophyton rubrum CBS 289.86] gi|607938870|gb|EZF72193.1| hypothetical protein H105_05763 [Trichophyton soudanense CBS 452.61] gi|607950789|gb|EZF82763.1| hypothetical protein H110_05744 [Trichophyton rubrum MR1448] gi|607963119|gb|EZF93622.1| hypothetical protein H113_05792 [Trichophyton rubrum MR1459] gi|607975470|gb|EZG04700.1| hypothetical protein H106_05586 [Trichophyton rubrum CBS 735.88] gi|607987174|gb|EZG15238.1| hypothetical protein H107_05887 [Trichophyton rubrum CBS 202.88] Length = 415 Score = 101 bits (252), Expect = 1e-19 Identities = 49/73 (67%), Positives = 60/73 (82%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 A LGG ERFVG D+P+L+P VS++LL + DLVSEE+L +W +ASKKYVDIATS+KVR Sbjct: 333 ALLGGTERFVGKDRPNLLPMVSSILLTYYQHDLVSEELLKSWGTKASKKYVDIATSKKVR 392 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 393 KSAEKFLEWLETA 405 >gb|EUC41222.1| hypothetical protein COCMIDRAFT_9048 [Bipolaris oryzae ATCC 44560] Length = 415 Score = 101 bits (252), Expect = 1e-19 Identities = 47/72 (65%), Positives = 61/72 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGI+KP LIP VSA+LL+++ +DLVSEE L TW +ASK+YVD+ S+ VR Sbjct: 335 AFLGGIERFVGIEKPELIPQVSAILLKVYENDLVSEEQLQTWCSKASKRYVDLKVSKTVR 394 Query: 181 KSAEKFLSWLKE 216 KSAE+F +WL++ Sbjct: 395 KSAEQFKNWLEQ 406 >gb|EUC31435.1| hypothetical protein COCCADRAFT_101281 [Bipolaris zeicola 26-R-13] gi|578483678|gb|EUN21233.1| hypothetical protein COCVIDRAFT_114495 [Bipolaris victoriae FI3] Length = 415 Score = 101 bits (252), Expect = 1e-19 Identities = 47/72 (65%), Positives = 61/72 (84%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 AFLGGIERFVGI+KP LIP VSA+LL+++ +DLVSEE L TW +ASK+YVD+ S+ VR Sbjct: 335 AFLGGIERFVGIEKPELIPQVSAILLKVYENDLVSEEQLQTWCSKASKRYVDLKVSKTVR 394 Query: 181 KSAEKFLSWLKE 216 KSAE+F +WL++ Sbjct: 395 KSAEQFKNWLEQ 406 >gb|EGD93608.1| eukaryotic translation initiation factor 5 [Trichophyton tonsurans CBS 112818] gi|607888552|gb|EZF29344.1| hypothetical protein H101_06978 [Trichophyton interdigitale H6] Length = 434 Score = 101 bits (252), Expect = 1e-19 Identities = 49/73 (67%), Positives = 60/73 (82%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 A LGG ERFVG D+P+L+P VS++LL + DLVSEE+L +W +ASKKYVDIATS+KVR Sbjct: 351 ALLGGTERFVGKDRPNLLPMVSSILLTYYQHDLVSEELLKSWGTKASKKYVDIATSKKVR 410 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 411 KSAEKFLEWLETA 423 >ref|XP_003236408.1| eukaryotic translation initiation factor 5 [Trichophyton rubrum CBS 118892] gi|326461750|gb|EGD87203.1| eukaryotic translation initiation factor 5 [Trichophyton rubrum CBS 118892] gi|607871055|gb|EZF16292.1| hypothetical protein H100_05755 [Trichophyton rubrum MR850] gi|607902884|gb|EZF40428.1| hypothetical protein H102_05723 [Trichophyton rubrum CBS 100081] gi|607914866|gb|EZF50936.1| hypothetical protein H103_05751 [Trichophyton rubrum CBS 288.86] gi|607927018|gb|EZF61651.1| hypothetical protein H104_05735 [Trichophyton rubrum CBS 289.86] gi|607938869|gb|EZF72192.1| hypothetical protein H105_05763 [Trichophyton soudanense CBS 452.61] gi|607950788|gb|EZF82762.1| hypothetical protein H110_05744 [Trichophyton rubrum MR1448] gi|607963118|gb|EZF93621.1| hypothetical protein H113_05792 [Trichophyton rubrum MR1459] gi|607975469|gb|EZG04699.1| hypothetical protein H106_05586 [Trichophyton rubrum CBS 735.88] gi|607987173|gb|EZG15237.1| hypothetical protein H107_05887 [Trichophyton rubrum CBS 202.88] Length = 433 Score = 101 bits (252), Expect = 1e-19 Identities = 49/73 (67%), Positives = 60/73 (82%) Frame = +1 Query: 1 AFLGGIERFVGIDKPSLIPSVSAVLLQIFNSDLVSEEVLLTWDGRASKKYVDIATSRKVR 180 A LGG ERFVG D+P+L+P VS++LL + DLVSEE+L +W +ASKKYVDIATS+KVR Sbjct: 351 ALLGGTERFVGKDRPNLLPMVSSILLTYYQHDLVSEELLKSWGTKASKKYVDIATSKKVR 410 Query: 181 KSAEKFLSWLKEA 219 KSAEKFL WL+ A Sbjct: 411 KSAEKFLEWLETA 423