BLASTX nr result
ID: Cocculus23_contig00051711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051711 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 112 5e-23 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 112 7e-23 gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis A... 111 1e-22 gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia... 110 2e-22 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 110 2e-22 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 110 3e-22 gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destr... 110 3e-22 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 110 3e-22 gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis... 108 6e-22 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 108 6e-22 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 108 6e-22 ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fucke... 108 8e-22 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 107 1e-21 gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicol... 107 1e-21 emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpu... 107 2e-21 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 107 2e-21 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 106 3e-21 gb|EMR69305.1| putative 40s ribosomal protein s28 protein [Eutyp... 106 3e-21 gb|EMF09855.1| ribosomal protein S28e, partial [Sphaerulina musi... 106 3e-21 gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioid... 106 4e-21 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] Length = 68 Score = 112 bits (280), Expect = 5e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 112 bits (279), Expect = 7e-23 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -1 Query: 366 AKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 AKM+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 45 AKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 102 >gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 111 bits (277), Expect = 1e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 110 bits (276), Expect = 2e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] Length = 68 Score = 110 bits (275), Expect = 2e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 110 bits (274), Expect = 3e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 110 bits (274), Expect = 3e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] Length = 68 Score = 110 bits (274), Expect = 3e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 108 bits (271), Expect = 6e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 108 bits (271), Expect = 6e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] Length = 68 Score = 108 bits (271), Expect = 6e-22 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fuckeliana B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botryotinia fuckeliana T4] Length = 68 Score = 108 bits (270), Expect = 8e-22 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 107 bits (268), Expect = 1e-21 Identities = 54/56 (96%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILC 56 >gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] Length = 68 Score = 107 bits (268), Expect = 1e-21 Identities = 54/56 (96%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] Length = 68 Score = 107 bits (267), Expect = 2e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] Length = 68 Score = 107 bits (267), Expect = 2e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] Length = 68 Score = 106 bits (265), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EMR69305.1| putative 40s ribosomal protein s28 protein [Eutypa lata UCREL1] Length = 68 Score = 106 bits (265), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAK PVKLV+VTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKQPVKLVRVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EMF09855.1| ribosomal protein S28e, partial [Sphaerulina musiva SO2202] Length = 67 Score = 106 bits (265), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDSAKVPVKLVKV +VLGRTGSRGGV QVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVIKVLGRTGSRGGVCQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioides Cg-14] Length = 162 Score = 106 bits (264), Expect = 4e-21 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = -1 Query: 360 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 193 MDS K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSTKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56