BLASTX nr result
ID: Cocculus23_contig00051042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051042 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME77428.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocer... 58 1e-06 >gb|EME77428.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocercospora fijiensis CIRAD86] Length = 309 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 6 VTAEQADMEKVTVDGKEKTKCNCGSESGKCPCEP 107 VT E+A+MEKV V G+EKTKCNC GKCPCEP Sbjct: 264 VTPEEAEMEKVIVAGQEKTKCNCAGAEGKCPCEP 297