BLASTX nr result
ID: Cocculus23_contig00050471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00050471 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49667.1| hypothetical protein DOTSEDRAFT_68446 [Dothistrom... 59 9e-07 >gb|EME49667.1| hypothetical protein DOTSEDRAFT_68446 [Dothistroma septosporum NZE10] Length = 906 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -2 Query: 344 QSFSSPPHTPMYNVXXXXXXXXXXP-ITGNIIMENTPPQSAPASQQCFPSGIFM 186 Q+ SSPPHTPM++ + GN I ENTPPQSAPA+QQ FPS +FM Sbjct: 653 QNVSSPPHTPMFHHHGQQVQQFNHCRVGGNAITENTPPQSAPAAQQTFPSSVFM 706