BLASTX nr result
ID: Cocculus23_contig00050401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00050401 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007601410.1| hypothetical protein CFIO01_08416 [Colletotr... 63 5e-08 gb|EQB51140.1| hypothetical protein CGLO_09362 [Colletotrichum g... 62 1e-07 ref|XP_007283510.1| antigenic cell wall [Colletotrichum gloeospo... 62 1e-07 ref|XP_383299.1| hypothetical protein FG03123.1 [Fusarium gramin... 61 1e-07 gb|EWG52014.1| hypothetical protein FVEG_10848 [Fusarium vertici... 60 3e-07 gb|EGU77063.1| hypothetical protein FOXB_12446 [Fusarium oxyspor... 60 3e-07 gb|EKJ77602.1| hypothetical protein FPSE_02100 [Fusarium pseudog... 59 5e-07 ref|XP_007584926.1| putative antigenic cell wall protein [Neofus... 59 9e-07 gb|EFQ36520.1| hypothetical protein GLRG_11666 [Colletotrichum g... 59 9e-07 gb|EJP68100.1| antigenic cell wall galactomannoprotein, putative... 57 2e-06 gb|EPE08102.1| antigenic cell wall galactomannoprotein [Ophiosto... 57 3e-06 ref|XP_664399.1| hypothetical protein AN6795.2 [Aspergillus nidu... 57 3e-06 gb|ETS72977.1| hypothetical protein PFICI_15369 [Pestalotiopsis ... 55 8e-06 gb|ELR08776.1| hypothetical protein GMDG_03454 [Pseudogymnoascus... 55 8e-06 gb|EHK49787.1| hypothetical protein TRIATDRAFT_314657 [Trichoder... 55 8e-06 >ref|XP_007601410.1| hypothetical protein CFIO01_08416 [Colletotrichum fioriniae PJ7] gi|588892693|gb|EXF74961.1| hypothetical protein CFIO01_08416 [Colletotrichum fioriniae PJ7] Length = 168 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/77 (42%), Positives = 47/77 (61%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 LS V T+ + AKP+FD + +S ++ +LK ++ TD+F AAVI KVP + A Sbjct: 92 LSSGVQTTLTAVVDAKPKFDKLLLSPVILLNLKSEQSATDKFSAAVIEKVPEALQAFAKT 151 Query: 127 VIAAIDAKFQEAINAYS 77 +IA IDA F AI+ YS Sbjct: 152 LIAPIDAAFNNAIDTYS 168 >gb|EQB51140.1| hypothetical protein CGLO_09362 [Colletotrichum gloeosporioides Cg-14] Length = 168 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/77 (40%), Positives = 46/77 (59%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ V T+ N + AKP+FD + +S I+ +LK K+ TD+F AAV+ KVP A Sbjct: 92 LAGGVETTLGNVVDAKPKFDKLLLSPIILLNLKQEKSATDKFSAAVVEKVPEALQGAAKT 151 Query: 127 VIAAIDAKFQEAINAYS 77 ++A I+ F AI+ YS Sbjct: 152 LVAQIETAFNNAIDTYS 168 >ref|XP_007283510.1| antigenic cell wall [Colletotrichum gloeosporioides Nara gc5] gi|429852312|gb|ELA27455.1| antigenic cell wall [Colletotrichum gloeosporioides Nara gc5] Length = 168 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/77 (40%), Positives = 46/77 (59%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ V T+ N + AKP+FD + +S I+ +LK K+ TD+F AAV+ KVP A Sbjct: 92 LAGGVETTLGNVVDAKPKFDKLLLSPIILLNLKQEKSATDKFSAAVVEKVPEALQGAAKT 151 Query: 127 VIAAIDAKFQEAINAYS 77 ++A I+ F AI+ YS Sbjct: 152 LVAQIETAFNNAIDTYS 168 >ref|XP_383299.1| hypothetical protein FG03123.1 [Fusarium graminearum PH-1] gi|558860064|gb|ESU10147.1| hypothetical protein FGSG_03123 [Fusarium graminearum PH-1] gi|596545448|gb|EYB25523.1| hypothetical protein FG05_03123 [Fusarium graminearum] Length = 172 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ DV TID IAAKP+FD + VS ++ +LK + + F A++AKVP A Sbjct: 92 LTTDVTQTIDTIIAAKPKFDKLMVSPVILLNLKLQRALSADFSEAILAKVPKDLQGNAKA 151 Query: 127 VIAAIDAKFQEAINAYSAL 71 ++ ID F +AI YS+L Sbjct: 152 LVQGIDDSFAKAIKKYSSL 170 >gb|EWG52014.1| hypothetical protein FVEG_10848 [Fusarium verticillioides 7600] Length = 172 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/79 (40%), Positives = 44/79 (55%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 LS DV +TI+ IAAKP FD + VS ++ +L + + F AVI+KVP A Sbjct: 92 LSADVELTINTIIAAKPNFDRLQVSPVILLNLNLQRALSQDFSEAVISKVPKDLQGNAKA 151 Query: 127 VIAAIDAKFQEAINAYSAL 71 ++ ID F AI+ YS L Sbjct: 152 LVQGIDDSFARAISKYSKL 170 >gb|EGU77063.1| hypothetical protein FOXB_12446 [Fusarium oxysporum Fo5176] gi|475671776|gb|EMT69055.1| hypothetical protein FOC4_g10005154 [Fusarium oxysporum f. sp. cubense race 4] gi|477519442|gb|ENH71620.1| hypothetical protein FOC1_g10007860 [Fusarium oxysporum f. sp. cubense race 1] gi|517325805|emb|CCT75657.1| uncharacterized protein FFUJ_11689 [Fusarium fujikuroi IMI 58289] gi|587658999|gb|EWY81376.1| hypothetical protein FOYG_15637 [Fusarium oxysporum FOSC 3-a] gi|587686829|gb|EWZ33434.1| hypothetical protein FOZG_13182 [Fusarium oxysporum Fo47] gi|587712183|gb|EWZ83520.1| hypothetical protein FOWG_13394 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587737765|gb|EXA35481.1| hypothetical protein FOVG_13560 [Fusarium oxysporum f. sp. pisi HDV247] gi|590027095|gb|EXK28953.1| hypothetical protein FOMG_14806 [Fusarium oxysporum f. sp. melonis 26406] gi|590055442|gb|EXK82966.1| hypothetical protein FOQG_12662 [Fusarium oxysporum f. sp. raphani 54005] gi|591405365|gb|EXL40502.1| hypothetical protein FOCG_16935 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591444071|gb|EXL76614.1| hypothetical protein FOPG_08716 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591466545|gb|EXL97948.1| hypothetical protein FOIG_10239 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591487775|gb|EXM17533.1| hypothetical protein FOTG_14238 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 172 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/79 (40%), Positives = 44/79 (55%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 LS DV +TI+ IAAKP FD + VS ++ +L + + F AVI+KVP A Sbjct: 92 LSADVELTINTIIAAKPNFDRLQVSPVILLNLNLQRALSQDFSEAVISKVPKDLQGNAKA 151 Query: 127 VIAAIDAKFQEAINAYSAL 71 ++ ID F AI+ YS L Sbjct: 152 LVQGIDDSFARAISKYSKL 170 >gb|EKJ77602.1| hypothetical protein FPSE_02100 [Fusarium pseudograminearum CS3096] Length = 172 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/79 (39%), Positives = 45/79 (56%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ DV ID IAAKP+FD + VS ++ +LK + + F A++AKVP A Sbjct: 92 LTTDVTQVIDTIIAAKPKFDKLMVSPVILLNLKLQRALSADFSEAILAKVPKDLQGNAKA 151 Query: 127 VIAAIDAKFQEAINAYSAL 71 ++ ID F +AI YS+L Sbjct: 152 LVQGIDDSFAKAIKKYSSL 170 >ref|XP_007584926.1| putative antigenic cell wall protein [Neofusicoccum parvum UCRNP2] gi|485922000|gb|EOD47601.1| putative antigenic cell wall protein [Neofusicoccum parvum UCRNP2] Length = 181 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNI---SVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASI 137 L +N +DN +A KP FD++ +++ +V L+D K+ FG AV AK+ YA+ Sbjct: 102 LQPQINSVLDNVVAKKPAFDSVQNGALNGLVSQSLQDQKSGAAAFGDAVTAKLTPTYAAQ 161 Query: 136 ANGVIAAIDAKFQEAINAYS 77 A + AI AKF EAI AYS Sbjct: 162 APAINQAIQAKFDEAIAAYS 181 >gb|EFQ36520.1| hypothetical protein GLRG_11666 [Colletotrichum graminicola M1.001] Length = 168 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/77 (37%), Positives = 44/77 (57%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ V T+ N + AKP+FD + +S ++ +LK K+ TD+F AAV+ KVP A Sbjct: 92 LAGGVETTLGNVVDAKPKFDKLLLSPVILLNLKQEKSATDKFSAAVVEKVPKSLKGAAET 151 Query: 127 VIAAIDAKFQEAINAYS 77 ++ I F +AI YS Sbjct: 152 LVGRIGTAFNDAIATYS 168 >gb|EJP68100.1| antigenic cell wall galactomannoprotein, putative [Beauveria bassiana ARSEF 2860] Length = 166 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDN-ISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIAN 131 L+ DVN IDN + KP+FDN + V+ I++ ++ + T AA++ K+P + A +A Sbjct: 89 LADDVNTVIDNLVRTKPKFDNWVIVTPIIKVVIEQQRDATKDLCAAILQKIPKELADVAA 148 Query: 130 GVIAAIDAKFQEAINAYS 77 +I ID KF E I A+S Sbjct: 149 ILIKQIDDKFVEGIKAFS 166 >gb|EPE08102.1| antigenic cell wall galactomannoprotein [Ophiostoma piceae UAMH 11346] Length = 177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/77 (38%), Positives = 46/77 (59%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L+ VN T+ IAA +F+++ ++ +V LK K +D A++AKVP+ IA Sbjct: 96 LATSVNSTMTTIIAAHEKFEHLLLAPVVLLDLKAQKAASDDMSNAIVAKVPAALQGIAQN 155 Query: 127 VIAAIDAKFQEAINAYS 77 ++A IDA F AI+AYS Sbjct: 156 LVAPIDASFNLAIDAYS 172 >ref|XP_664399.1| hypothetical protein AN6795.2 [Aspergillus nidulans FGSC A4] gi|40739423|gb|EAA58613.1| hypothetical protein AN6795.2 [Aspergillus nidulans FGSC A4] gi|259480390|tpe|CBF71476.1| TPA: antigenic cell wall galactomannoprotein, putative (AFU_orthologue; AFUA_4G00870) [Aspergillus nidulans FGSC A4] Length = 188 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 5/81 (6%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNI-----SVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYA 143 L +++ T+DN ++ KP+FDN S++F+V S+L+ K + G AV+ K+ YA Sbjct: 107 LQPNIDSTLDNIVSKKPQFDNGLLGIGSLAFLVRSNLEKQKELAGELGDAVVLKLTKTYA 166 Query: 142 SIANGVIAAIDAKFQEAINAY 80 IA + A I AKF+EAI A+ Sbjct: 167 VIAPLLNAQIQAKFEEAIAAF 187 >gb|ETS72977.1| hypothetical protein PFICI_15369 [Pestalotiopsis fici W106-1] Length = 172 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISVSFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIANG 128 L D N T+ IAAKP+FD + +S I+ L K + + +A+ KVP Y ++A+ Sbjct: 94 LITDTNSTLTEIIAAKPKFDKLLLSPIIYLTLSSQKDASGKLSSAIAEKVPEAYQTVADA 153 Query: 127 VIAAIDAKFQEAINAYSAL 71 + A + A F A++AYS L Sbjct: 154 LGAELAASFDVALDAYSFL 172 >gb|ELR08776.1| hypothetical protein GMDG_03454 [Pseudogymnoascus destructans 20631-21] Length = 259 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISV-SFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIAN 131 L V ++ + KPRFD + V S I+ +LK K TD+F AVI K+P ++ +IA Sbjct: 179 LVTSVQSSLQTILRTKPRFDRLLVISPIILINLKQQKAATDKFSKAVITKLPEEFRAIAE 238 Query: 130 GVIAAIDAKFQEAINAY 80 + A ID F +AI Y Sbjct: 239 SITAPIDVAFNDAIAKY 255 >gb|EHK49787.1| hypothetical protein TRIATDRAFT_314657 [Trichoderma atroviride IMI 206040] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/77 (41%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Frame = -2 Query: 307 LSRDVNITIDNFIAAKPRFDNISV-SFIVESHLKDTKTKTDQFGAAVIAKVPSQYASIAN 131 L+ DVN TI I KP+FD + V ++ +LK + T +F AAV+AKVP S+A Sbjct: 93 LATDVNQTITTIINTKPKFDKLLVVDPVILLNLKLEQDATRKFSAAVVAKVPEALQSVAQ 152 Query: 130 GVIAAIDAKFQEAINAY 80 G+ ID F E I Y Sbjct: 153 GLTQGIDDSFSEGIAVY 169