BLASTX nr result
ID: Cocculus23_contig00050027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00050027 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433351.1| hypothetical protein CICLE_v10003670mg [Citr... 60 2e-07 ref|XP_006472040.1| PREDICTED: wall-associated receptor kinase-l... 60 3e-07 ref|XP_006433353.1| hypothetical protein CICLE_v10001697mg [Citr... 60 3e-07 ref|XP_006490000.1| PREDICTED: wall-associated receptor kinase-l... 59 7e-07 ref|XP_006494380.1| PREDICTED: wall-associated receptor kinase-l... 58 2e-06 ref|XP_006421358.1| hypothetical protein CICLE_v10005345mg [Citr... 57 2e-06 emb|CAB41180.1| putative protein [Arabidopsis thaliana] 57 2e-06 ref|NP_567053.1| putative protein kinase [Arabidopsis thaliana] ... 57 3e-06 ref|XP_006485620.1| PREDICTED: putative wall-associated receptor... 57 3e-06 ref|XP_006436462.1| hypothetical protein CICLE_v10033856mg [Citr... 57 3e-06 ref|XP_006433369.1| hypothetical protein CICLE_v100015431mg, par... 57 4e-06 ref|XP_006433350.1| hypothetical protein CICLE_v10001741mg [Citr... 56 5e-06 ref|XP_006389955.1| hypothetical protein EUTSA_v10019749mg, part... 56 5e-06 ref|XP_002876436.1| hypothetical protein ARALYDRAFT_486225 [Arab... 56 6e-06 >ref|XP_006433351.1| hypothetical protein CICLE_v10003670mg [Citrus clementina] gi|557535473|gb|ESR46591.1| hypothetical protein CICLE_v10003670mg [Citrus clementina] Length = 329 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/71 (43%), Positives = 40/71 (56%) Frame = +2 Query: 5 RRMKRKLFRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFI 184 R+ K + N K F N LKELI + +GK NP +F+A+EL ATNNYD I Sbjct: 7 RKFKHRRDTERNDKTTFMMRNGEKLLKELIASSNGKYNPYRIFSAEELRIATNNYDEQNI 66 Query: 185 IRREPFYDLYK 217 + +PF LYK Sbjct: 67 VLEDPFRKLYK 77 >ref|XP_006472040.1| PREDICTED: wall-associated receptor kinase-like 17-like [Citrus sinensis] Length = 386 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/71 (45%), Positives = 40/71 (56%) Frame = +2 Query: 5 RRMKRKLFRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFI 184 R+ K + + K F N LKELI+A +GK NP F+AKEL ATNNYD + Sbjct: 6 RKFKLRERTQSTDKATFVIRNGESVLKELIRASNGKYNPYCTFSAKELEIATNNYDSEKV 65 Query: 185 IRREPFYDLYK 217 I + FY LYK Sbjct: 66 IMKRSFYTLYK 76 >ref|XP_006433353.1| hypothetical protein CICLE_v10001697mg [Citrus clementina] gi|557535475|gb|ESR46593.1| hypothetical protein CICLE_v10001697mg [Citrus clementina] Length = 347 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/71 (45%), Positives = 40/71 (56%) Frame = +2 Query: 5 RRMKRKLFRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFI 184 R+ K + + K F N LKELI+A +GK NP F+AKEL ATNNYD + Sbjct: 6 RKFKLRERTQSTDKATFVIRNGESVLKELIRASNGKYNPYCTFSAKELEIATNNYDSEKV 65 Query: 185 IRREPFYDLYK 217 I + FY LYK Sbjct: 66 IMKRSFYTLYK 76 >ref|XP_006490000.1| PREDICTED: wall-associated receptor kinase-like 8-like [Citrus sinensis] Length = 343 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 17 RKLFRTNNKKKDFSTENNG-LFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRR 193 RK+ R+ +K NG +FL++LIK+ + KRNP+ + AKEL ATNNYD + +I+ Sbjct: 6 RKIKRSEREKTKIYVMRNGEMFLEKLIKSCNNKRNPLHCYCAKELMSATNNYDKHKVIKT 65 Query: 194 EPFYDLYK 217 Y+LYK Sbjct: 66 GMSYELYK 73 >ref|XP_006494380.1| PREDICTED: wall-associated receptor kinase-like 8-like [Citrus sinensis] Length = 343 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 17 RKLFRTNNKKKDFSTENNG-LFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRR 193 RK+ R+ +K NG +FL++LIK+ + KRNP+ + A+EL ATNNYD + +I+ Sbjct: 6 RKIKRSEREKTKIYVMRNGEMFLEKLIKSCNNKRNPLRCYCAEELMSATNNYDKHKVIKT 65 Query: 194 EPFYDLYK 217 Y+LYK Sbjct: 66 GMSYELYK 73 >ref|XP_006421358.1| hypothetical protein CICLE_v10005345mg [Citrus clementina] gi|557523231|gb|ESR34598.1| hypothetical protein CICLE_v10005345mg [Citrus clementina] Length = 343 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 17 RKLFRTNNKKKDFSTENNG-LFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRR 193 RK+ R+ +K NG +FL++LIK+ + KRNP+ + A+EL ATNNYD + +I+ Sbjct: 6 RKIKRSEREKTKIYVMRNGEMFLEKLIKSCNNKRNPLHCYCAEELMSATNNYDKHKVIKT 65 Query: 194 EPFYDLYK 217 Y+LYK Sbjct: 66 GMSYELYK 73 >emb|CAB41180.1| putative protein [Arabidopsis thaliana] Length = 372 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/68 (36%), Positives = 44/68 (64%) Frame = +2 Query: 20 KLFRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREP 199 ++ + N KK+ + +N G+ L+ELI +FDGK NPI F++ ++ KAT+N+ + II Sbjct: 38 EMSKNNKKKRRWDLKNGGILLEELIASFDGKTNPIRCFSSDQILKATDNFSESRIISSWG 97 Query: 200 FYDLYKAI 223 ++ YK + Sbjct: 98 YFIWYKGV 105 >ref|NP_567053.1| putative protein kinase [Arabidopsis thaliana] gi|79315431|ref|NP_001030878.1| putative protein kinase [Arabidopsis thaliana] gi|21536609|gb|AAM60941.1| protein kinase-like protein [Arabidopsis thaliana] gi|51968380|dbj|BAD42882.1| protein kinase - like protein [Arabidopsis thaliana] gi|332646172|gb|AEE79693.1| putative protein kinase [Arabidopsis thaliana] gi|332646173|gb|AEE79694.1| putative protein kinase [Arabidopsis thaliana] Length = 334 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/65 (38%), Positives = 42/65 (64%) Frame = +2 Query: 29 RTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFYD 208 + N KK+ + +N G+ L+ELI +FDGK NPI F++ ++ KAT+N+ + II ++ Sbjct: 3 KNNKKKRRWDLKNGGILLEELIASFDGKTNPIRCFSSDQILKATDNFSESRIISSWGYFI 62 Query: 209 LYKAI 223 YK + Sbjct: 63 WYKGV 67 >ref|XP_006485620.1| PREDICTED: putative wall-associated receptor kinase-like 16-like isoform X1 [Citrus sinensis] gi|568864470|ref|XP_006485621.1| PREDICTED: putative wall-associated receptor kinase-like 16-like isoform X2 [Citrus sinensis] Length = 344 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = +2 Query: 41 KKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFYDLYK 217 +K+ F +N L++LI + +G NPI FTA+EL ATNNYDP +I ++ Y LYK Sbjct: 15 EKRKFMLKNGKFLLQKLIASCNGDYNPIQNFTAQELKAATNNYDPEKVITKDLLYKLYK 73 >ref|XP_006436462.1| hypothetical protein CICLE_v10033856mg [Citrus clementina] gi|557538658|gb|ESR49702.1| hypothetical protein CICLE_v10033856mg [Citrus clementina] Length = 344 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = +2 Query: 41 KKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFYDLYK 217 +K+ F +N L++LI + +G NPI FTA+EL ATNNYDP +I ++ Y LYK Sbjct: 15 EKRKFMLKNGKFLLQKLIASCNGDYNPIQNFTAQELKAATNNYDPEKVITKDLLYKLYK 73 >ref|XP_006433369.1| hypothetical protein CICLE_v100015431mg, partial [Citrus clementina] gi|557535491|gb|ESR46609.1| hypothetical protein CICLE_v100015431mg, partial [Citrus clementina] Length = 328 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/64 (43%), Positives = 36/64 (56%) Frame = +2 Query: 26 FRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFY 205 F+ K+ N LKELI + GK NP +F+AKEL ATNNYD I+++ Y Sbjct: 8 FKDRTDKRTLMVRNGARVLKELIASSHGKYNPYRIFSAKELEIATNNYDERKFIKQDSTY 67 Query: 206 DLYK 217 LYK Sbjct: 68 KLYK 71 >ref|XP_006433350.1| hypothetical protein CICLE_v10001741mg [Citrus clementina] gi|568835997|ref|XP_006472036.1| PREDICTED: wall-associated receptor kinase-like 22-like [Citrus sinensis] gi|557535472|gb|ESR46590.1| hypothetical protein CICLE_v10001741mg [Citrus clementina] Length = 339 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = +2 Query: 65 NNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFYDLYK 217 N L L++LI F+GKRNPI F+AK+L KATNNYD + +I+ + Y L++ Sbjct: 23 NEKLLLQKLIATFNGKRNPIRAFSAKDLKKATNNYDLHKVIQSDTSYRLFE 73 >ref|XP_006389955.1| hypothetical protein EUTSA_v10019749mg, partial [Eutrema salsugineum] gi|557086389|gb|ESQ27241.1| hypothetical protein EUTSA_v10019749mg, partial [Eutrema salsugineum] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/70 (34%), Positives = 44/70 (62%) Frame = +2 Query: 14 KRKLFRTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRR 193 + K ++ DFS +N GL ++ELI+ +G NP +F+A+EL +ATN+YD + ++ Sbjct: 12 RTKTTTSSRSHSDFSLKNGGLMVEELIRISNGDYNPFCIFSARELEQATNDYDQDLVLPL 71 Query: 194 EPFYDLYKAI 223 + Y L++ + Sbjct: 72 DTNYRLFQGV 81 >ref|XP_002876436.1| hypothetical protein ARALYDRAFT_486225 [Arabidopsis lyrata subsp. lyrata] gi|297322274|gb|EFH52695.1| hypothetical protein ARALYDRAFT_486225 [Arabidopsis lyrata subsp. lyrata] Length = 334 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/65 (38%), Positives = 41/65 (63%) Frame = +2 Query: 29 RTNNKKKDFSTENNGLFLKELIKAFDGKRNPIMVFTAKELAKATNNYDPNFIIRREPFYD 208 + N KK+ +N G+ L+ELI +FDGK NPI F++ ++ KAT+N+ + II ++ Sbjct: 3 KNNKKKRRSDLKNGGILLEELIASFDGKTNPIRCFSSDQILKATDNFSESRIISSWGYFI 62 Query: 209 LYKAI 223 YK + Sbjct: 63 WYKGV 67