BLASTX nr result
ID: Cocculus23_contig00049948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049948 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15973.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 emb|CAN72716.1| hypothetical protein VITISV_032470 [Vitis vinifera] 81 1e-13 ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus... 73 5e-11 ref|XP_004241167.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] 69 7e-10 ref|XP_007206426.1| hypothetical protein PRUPE_ppa001946mg [Prun... 64 2e-08 ref|XP_004145320.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006293749.1| hypothetical protein CARUB_v10022711mg [Caps... 62 8e-08 ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004295750.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_002525630.1| pentatricopeptide repeat-containing protein,... 62 1e-07 ref|XP_002879234.1| predicted protein [Arabidopsis lyrata subsp.... 61 1e-07 gb|EPS69071.1| hypothetical protein M569_05691, partial [Genlise... 61 2e-07 ref|XP_007016122.1| Tetratricopeptide repeat (TPR)-like superfam... 61 2e-07 ref|XP_002314110.1| pentatricopeptide repeat-containing family p... 61 2e-07 ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citr... 59 9e-07 ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Popu... 58 2e-06 ref|NP_180537.1| RNA editing factor OTP81 [Arabidopsis thaliana]... 58 2e-06 >emb|CBI15973.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 81.3 bits (199), Expect = 1e-13 Identities = 46/85 (54%), Positives = 59/85 (69%) Frame = +2 Query: 17 HRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFD 196 H +P P ++T NDRY + P+ LSLI++CS T LKQIHA MLR G+FFD F Sbjct: 15 HSLPTPNPNSITLNNDRY---FANHPT-LSLIDQCSETKQLKQIHAQMLRTGLFFD-PFS 69 Query: 197 ASRLLTLYSLSDFSPSLDYSRKVFD 271 ASRL+T +LS F PSLDY+++VFD Sbjct: 70 ASRLITAAALSPF-PSLDYAQQVFD 93 >ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 743 Score = 81.3 bits (199), Expect = 1e-13 Identities = 46/85 (54%), Positives = 59/85 (69%) Frame = +2 Query: 17 HRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFD 196 H +P P ++T NDRY + P+ LSLI++CS T LKQIHA MLR G+FFD F Sbjct: 15 HSLPTPNPNSITLNNDRY---FANHPT-LSLIDQCSETKQLKQIHAQMLRTGLFFD-PFS 69 Query: 197 ASRLLTLYSLSDFSPSLDYSRKVFD 271 ASRL+T +LS F PSLDY+++VFD Sbjct: 70 ASRLITAAALSPF-PSLDYAQQVFD 93 >emb|CAN72716.1| hypothetical protein VITISV_032470 [Vitis vinifera] Length = 694 Score = 81.3 bits (199), Expect = 1e-13 Identities = 46/85 (54%), Positives = 59/85 (69%) Frame = +2 Query: 17 HRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFD 196 H +P P ++T NDRY + P+ LSLI++CS T LKQIHA MLR G+FFD F Sbjct: 15 HSLPTPNPNSITLNNDRY---FANHPT-LSLIDQCSETKQLKQIHAQMLRTGLFFD-PFS 69 Query: 197 ASRLLTLYSLSDFSPSLDYSRKVFD 271 ASRL+T +LS F PSLDY+++VFD Sbjct: 70 ASRLITAAALSPF-PSLDYAQQVFD 93 >ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 744 Score = 73.2 bits (178), Expect = 4e-11 Identities = 44/90 (48%), Positives = 57/90 (63%) Frame = +2 Query: 2 RHQHHHRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFF 181 RHQH + P P + T INDRY + ++ LI++C + LKQIHA+MLR G+F Sbjct: 13 RHQHFPK---PNPISKTVINDRY----FENHPLVLLIDKCQSIKQLKQIHAYMLRIGLFS 65 Query: 182 DSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 D F AS+L+ SLS FS SLDY+ KVFD Sbjct: 66 D-PFSASKLIEASSLSHFS-SLDYAHKVFD 93 >gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus guttatus] Length = 701 Score = 72.8 bits (177), Expect = 5e-11 Identities = 42/80 (52%), Positives = 55/80 (68%) Frame = +2 Query: 32 PTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLL 211 P +T NDRY + P++ +LIE+CSN+ LKQIHA MLRCG+FFD F AS+L+ Sbjct: 7 PLTNFVTVNNDRY---FANHPTV-TLIEKCSNSRQLKQIHAQMLRCGLFFD-PFSASKLV 61 Query: 212 TLYSLSDFSPSLDYSRKVFD 271 Y+LS+ S SL Y+ KVFD Sbjct: 62 QSYALSELS-SLHYAYKVFD 80 >ref|XP_004241167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 744 Score = 72.0 bits (175), Expect = 8e-11 Identities = 44/90 (48%), Positives = 57/90 (63%) Frame = +2 Query: 2 RHQHHHRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFF 181 RHQH + P P + T INDRY + ++ LI++ + LKQIHA+MLR G+FF Sbjct: 13 RHQHFPK---PNPISKTVINDRY----FENHPLVLLIDKSQSINQLKQIHAYMLRIGLFF 65 Query: 182 DSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 D F AS+L+ SLS FS SLDY+ KVFD Sbjct: 66 D-PFSASKLIEASSLSHFS-SLDYAHKVFD 93 >gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] Length = 739 Score = 68.9 bits (167), Expect = 7e-10 Identities = 41/85 (48%), Positives = 57/85 (67%) Frame = +2 Query: 17 HRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFD 196 H+ + PT T +N+ RF +LSLIE+C++ LKQIHA MLR G+FFD F Sbjct: 13 HQRKLPTSST---VNNDLRF---PNYPLLSLIEQCTSLKELKQIHAQMLRTGLFFD-PFS 65 Query: 197 ASRLLTLYSLSDFSPSLDYSRKVFD 271 AS+L+T+ ++S FS SLDY+ +VFD Sbjct: 66 ASKLITVCAMSSFS-SLDYAHQVFD 89 >ref|XP_007206426.1| hypothetical protein PRUPE_ppa001946mg [Prunus persica] gi|462402068|gb|EMJ07625.1| hypothetical protein PRUPE_ppa001946mg [Prunus persica] Length = 738 Score = 64.3 bits (155), Expect = 2e-08 Identities = 38/80 (47%), Positives = 53/80 (66%) Frame = +2 Query: 32 PTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLL 211 P + TF D R+ P+ LSLI++C++ LKQ+HA MLR G+ FD + AS+L+ Sbjct: 15 PNSSSPTFSTD---LRFSSHPA-LSLIDQCTSIKQLKQVHAQMLRTGVLFD-PYSASKLI 69 Query: 212 TLYSLSDFSPSLDYSRKVFD 271 T +LS FS SLDY+R+VFD Sbjct: 70 TASALSSFS-SLDYARQVFD 88 >ref|XP_004145320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis sativus] gi|449470513|ref|XP_004152961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis sativus] gi|449523079|ref|XP_004168552.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis sativus] Length = 733 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/77 (46%), Positives = 52/77 (67%) Frame = +2 Query: 41 ETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLY 220 + + +N+ FR Q ILS I++CS++ LK++HA MLR G+FFD F AS+L T Sbjct: 12 QNFSTLNNNLLFRNHQ---ILSTIDKCSSSKQLKEVHARMLRTGLFFD-PFSASKLFTAS 67 Query: 221 SLSDFSPSLDYSRKVFD 271 +LS FS +LDY+R +FD Sbjct: 68 ALSSFS-TLDYARNLFD 83 >ref|XP_006293749.1| hypothetical protein CARUB_v10022711mg [Capsella rubella] gi|482562457|gb|EOA26647.1| hypothetical protein CARUB_v10022711mg [Capsella rubella] Length = 739 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +2 Query: 101 LSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 +SLI+RCSN LKQ HAHM+R G F D + AS+L + +LS F+ SL+Y+RKVFD Sbjct: 35 ISLIDRCSNLRQLKQTHAHMIRTGTFSD-PYSASKLFAIAALSSFA-SLEYARKVFD 89 >ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Citrus sinensis] Length = 746 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/80 (45%), Positives = 48/80 (60%) Frame = +2 Query: 32 PTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLL 211 P P TLT N + + SLI++C N LKQIH MLR G+FFD + AS+L Sbjct: 24 PNPTTLTVNNGHQHHPH----PVFSLIKQCKNIKQLKQIHTQMLRTGLFFD-PYSASKLF 78 Query: 212 TLYSLSDFSPSLDYSRKVFD 271 T +L FS SL+Y+R++FD Sbjct: 79 TPCALGTFS-SLEYAREMFD 97 >ref|XP_004295750.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1049 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/58 (53%), Positives = 44/58 (75%) Frame = +2 Query: 98 ILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 +L LI++C+ HLKQ+HA ML+ +FFD + AS+L+T +LS FS SLDY+R+VFD Sbjct: 89 LLPLIDQCTTLNHLKQVHAQMLKTSLFFD-PYSASKLITAAALSPFS-SLDYARQVFD 144 >ref|XP_002525630.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535066|gb|EEF36748.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 765 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/57 (54%), Positives = 46/57 (80%) Frame = +2 Query: 101 LSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 LSLI++C+N HLK++HA +LR G+FF ++AS+L ++ +LS FS SLDY+RKVF+ Sbjct: 35 LSLIDQCTNLKHLKELHATILRSGLFF-HPYNASKLFSVAALSSFS-SLDYARKVFE 89 >ref|XP_002879234.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297325073|gb|EFH55493.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 740 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = +2 Query: 2 RHQHHHRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFF 181 RH + PT N+R R +SLI+RCS+ LKQ HAHM+R G+F Sbjct: 14 RHPNFSNPNQPTTN-----NERSRHT-------ISLIDRCSSLRQLKQTHAHMIRTGMFS 61 Query: 182 DSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 D + AS+L + +LS F+ SL+Y+RKVFD Sbjct: 62 D-PYSASKLFAIAALSSFA-SLEYARKVFD 89 >gb|EPS69071.1| hypothetical protein M569_05691, partial [Genlisea aurea] Length = 726 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/65 (50%), Positives = 47/65 (72%) Frame = +2 Query: 77 RYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYS 256 R+L+ ++LI+RC++ LKQIH MLR G+ D F AS+L++L +LSDFS SL Y+ Sbjct: 6 RFLEKHPTVTLIDRCTSQKQLKQIHCQMLRSGL-LDDPFAASKLISLSALSDFS-SLAYA 63 Query: 257 RKVFD 271 +KVFD Sbjct: 64 QKVFD 68 >ref|XP_007016122.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786485|gb|EOY33741.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 733 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/58 (56%), Positives = 42/58 (72%) Frame = +2 Query: 98 ILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 +LS I +C+N LKQIHA MLR G+FF + + AS+L +LS FS SLDY+RKVFD Sbjct: 28 VLSRINQCTNLNQLKQIHAQMLRTGLFF-NPYSASKLFAASALSPFS-SLDYARKVFD 83 >ref|XP_002314110.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222850518|gb|EEE88065.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 738 Score = 60.8 bits (146), Expect = 2e-07 Identities = 39/82 (47%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Frame = +2 Query: 29 SPTPETLTFINDRYRFRYLQGPSILS-LIERCSNTAHLKQIHAHMLRCGIFFDSSFDASR 205 S P LT N++ PS + LI++C+N HLKQ+HAHMLR G+FFD A++ Sbjct: 14 SSNPTILTANNEQK-----SNPSTVPILIDKCANKKHLKQLHAHMLRTGLFFDPP-SATK 67 Query: 206 LLTLYSLSDFSPSLDYSRKVFD 271 L T +LS S SLDY+ KVFD Sbjct: 68 LFTACALSSPS-SLDYACKVFD 88 >ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] gi|557530863|gb|ESR42046.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] Length = 737 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/80 (43%), Positives = 47/80 (58%) Frame = +2 Query: 32 PTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLL 211 P TLT N + + SLI++C N LKQIH MLR G+FFD + AS+L Sbjct: 15 PNTTTLTVNNGHQHHPH----PVFSLIKQCKNIKQLKQIHTQMLRTGLFFD-PYSASKLF 69 Query: 212 TLYSLSDFSPSLDYSRKVFD 271 T +L FS SL+Y+R++FD Sbjct: 70 TPCALGTFS-SLEYAREMFD 88 >ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] gi|550318175|gb|ERP49729.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] Length = 717 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +2 Query: 92 PSILSLIERCSNTAHLKQIHAHMLRCGIFFDSSFDASRLLTLYSLSDFSPSLDYSRKVF 268 P I+S IE+CSN + LKQIHA MLR G+FFD F AS+++ SL D S SL Y+R VF Sbjct: 47 PCIVS-IEKCSNMSQLKQIHAQMLRTGLFFD-PFTASKIVAFCSLQD-SGSLQYARLVF 102 >ref|NP_180537.1| RNA editing factor OTP81 [Arabidopsis thaliana] gi|75100656|sp|O82380.1|PP175_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g29760, chloroplastic; Flags: Precursor gi|3582328|gb|AAC35225.1| hypothetical protein [Arabidopsis thaliana] gi|330253207|gb|AEC08301.1| RNA editing factor OTP81 [Arabidopsis thaliana] Length = 738 Score = 57.8 bits (138), Expect = 2e-06 Identities = 37/90 (41%), Positives = 49/90 (54%) Frame = +2 Query: 2 RHQHHHRTESPTPETLTFINDRYRFRYLQGPSILSLIERCSNTAHLKQIHAHMLRCGIFF 181 RH + PT N+R R +SLIERC + LKQ H HM+R G F Sbjct: 14 RHPNFSNPNQPTTN-----NERSRH--------ISLIERCVSLRQLKQTHGHMIRTGTFS 60 Query: 182 DSSFDASRLLTLYSLSDFSPSLDYSRKVFD 271 D + AS+L + +LS F+ SL+Y+RKVFD Sbjct: 61 D-PYSASKLFAMAALSSFA-SLEYARKVFD 88