BLASTX nr result
ID: Cocculus23_contig00049790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049790 (573 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, part... 41 5e-08 >ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] gi|462403259|gb|EMJ08816.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] Length = 1170 Score = 41.2 bits (95), Expect(3) = 5e-08 Identities = 19/39 (48%), Positives = 31/39 (79%) Frame = -2 Query: 560 HFNLLFNHDRKLRGKFKAARGVQQVDPLFPFPFTILVDV 444 +F+++ N + RGKF+A+RG++Q DPL PF FT+++DV Sbjct: 578 NFSVMING--RPRGKFRASRGLRQGDPLSPFLFTLVMDV 614 Score = 39.3 bits (90), Expect(3) = 5e-08 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 17/96 (17%) Frame = -3 Query: 442 LGRMLDKARSCGIVEGLVVGRE*MEVSHLYFADEGC-----------------RLLL*DI 314 L R+++KA+ + GL G +EVSHL FAD+ L Sbjct: 615 LSRIMEKAQDADMFHGLSPGLGMVEVSHLQFADDTIFFIEDKDEYWNNLLQILELFCFVS 674 Query: 313 R*HLNRSKCQILGIKMDTVEVRNLANTLHCSTGDDP 206 +N+SKC ++GI +D + LA C G P Sbjct: 675 GMEINKSKCSLVGINLDDGLLNELAGAWGCEVGAWP 710 Score = 21.6 bits (44), Expect(3) = 5e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 209 PMKYLRMPLGEN 174 PM YL +PLG N Sbjct: 710 PMSYLGLPLGGN 721