BLASTX nr result
ID: Cocculus23_contig00049649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049649 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74546.1| hypothetical protein VITISV_011096 [Vitis vinifera] 103 2e-20 emb|CAN74547.1| hypothetical protein VITISV_011097 [Vitis vinifera] 103 3e-20 gb|EXB30588.1| hypothetical protein L484_002779 [Morus notabilis] 92 1e-16 gb|EXB30589.1| hypothetical protein L484_002780 [Morus notabilis] 91 2e-16 ref|XP_002517994.1| conserved hypothetical protein [Ricinus comm... 91 2e-16 ref|XP_002525618.1| conserved hypothetical protein [Ricinus comm... 88 1e-15 ref|XP_002525614.1| conserved hypothetical protein [Ricinus comm... 88 1e-15 emb|CAN82205.1| hypothetical protein VITISV_000175 [Vitis vinifera] 88 1e-15 ref|XP_007025814.1| Uncharacterized protein TCM_030004 [Theobrom... 87 2e-15 emb|CAN74549.1| hypothetical protein VITISV_011099 [Vitis vinifera] 87 2e-15 emb|CAN74548.1| hypothetical protein VITISV_011098 [Vitis vinifera] 87 3e-15 ref|XP_006437900.1| hypothetical protein CICLE_v10033348mg [Citr... 86 4e-15 ref|XP_002525615.1| conserved hypothetical protein [Ricinus comm... 85 9e-15 emb|CAN82208.1| hypothetical protein VITISV_000178 [Vitis vinifera] 85 9e-15 emb|CAN82204.1| hypothetical protein VITISV_000174 [Vitis vinifera] 84 2e-14 ref|XP_007214205.1| hypothetical protein PRUPE_ppa021979mg [Prun... 82 6e-14 ref|XP_002525617.1| conserved hypothetical protein [Ricinus comm... 82 8e-14 ref|XP_007217675.1| hypothetical protein PRUPE_ppa024427mg [Prun... 81 1e-13 ref|XP_006432142.1| hypothetical protein CICLE_v10003665mg [Citr... 81 2e-13 ref|XP_002309907.1| hypothetical protein POPTR_0007s04060g [Popu... 81 2e-13 >emb|CAN74546.1| hypothetical protein VITISV_011096 [Vitis vinifera] Length = 95 Score = 103 bits (257), Expect = 2e-20 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = -2 Query: 259 FAVSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCV 80 F FGKAKST QC+SV GVR DTCF I+Q+ NMTA+ F+ INPNLNCD LFVGQWLCV Sbjct: 31 FLPVFGKAKSTPQCDSVVGVRSGDTCFAISQMSNMTAKAFSAINPNLNCDALFVGQWLCV 90 Query: 79 AGTAN 65 AGTAN Sbjct: 91 AGTAN 95 >emb|CAN74547.1| hypothetical protein VITISV_011097 [Vitis vinifera] Length = 95 Score = 103 bits (256), Expect = 3e-20 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -2 Query: 259 FAVSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCV 80 F FGKAKST QC+SV GVR DTCF I+Q+ NMTA+ F+ INPNLNCD LF+GQWLCV Sbjct: 31 FLPVFGKAKSTPQCDSVVGVRSGDTCFAISQMSNMTAKAFSAINPNLNCDALFIGQWLCV 90 Query: 79 AGTAN 65 AGTAN Sbjct: 91 AGTAN 95 >gb|EXB30588.1| hypothetical protein L484_002779 [Morus notabilis] Length = 83 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/69 (57%), Positives = 52/69 (75%), Gaps = 6/69 (8%) Frame = -2 Query: 253 VSFGKAKSTL------QCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQ 92 + FGKA+ QC+SVFGVR+ DTCF ++Q+FN+T EFF+++NPNLNC LFVG+ Sbjct: 11 ILFGKARKQANNILRPQCKSVFGVRQGDTCFAVSQMFNLTLEFFDSLNPNLNCTNLFVGE 70 Query: 91 WLCVAGTAN 65 WLCV GT N Sbjct: 71 WLCVDGTPN 79 >gb|EXB30589.1| hypothetical protein L484_002780 [Morus notabilis] Length = 149 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 256 AVSFGKAKSTL-QCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCV 80 AV GK++S + +C+SV+GV+ DTCF +TQ+FN+T FF ++NPNLNC LFVGQWLC Sbjct: 85 AVGIGKSESRVPKCDSVYGVQSGDTCFEVTQMFNLTTAFFGSVNPNLNCTALFVGQWLCT 144 Query: 79 AGTAN 65 AGT N Sbjct: 145 AGTPN 149 >ref|XP_002517994.1| conserved hypothetical protein [Ricinus communis] gi|223542976|gb|EEF44512.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/62 (59%), Positives = 47/62 (75%) Frame = -2 Query: 253 VSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAG 74 + FG AKST +C+SV+G + DTC + FN+T EFF++INPNLNCD FVGQWLC+ G Sbjct: 34 IGFGDAKSTPECDSVYGAQDGDTCTSVANQFNLTLEFFSSINPNLNCDDFFVGQWLCING 93 Query: 73 TA 68 TA Sbjct: 94 TA 95 >ref|XP_002525618.1| conserved hypothetical protein [Ricinus communis] gi|223535054|gb|EEF36736.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/62 (59%), Positives = 47/62 (75%) Frame = -2 Query: 253 VSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAG 74 V FG AKST +C+SV+G + DTC + F++T EFF++INPNLNCD +FVGQWLC G Sbjct: 43 VGFGNAKSTPECDSVYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDG 102 Query: 73 TA 68 TA Sbjct: 103 TA 104 >ref|XP_002525614.1| conserved hypothetical protein [Ricinus communis] gi|223535050|gb|EEF36732.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/62 (59%), Positives = 47/62 (75%) Frame = -2 Query: 253 VSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAG 74 V FG AKST +C+SV+G + DTC + F++T EFF++INPNLNCD +FVGQWLC G Sbjct: 43 VGFGNAKSTPECDSVYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDG 102 Query: 73 TA 68 TA Sbjct: 103 TA 104 >emb|CAN82205.1| hypothetical protein VITISV_000175 [Vitis vinifera] Length = 89 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/60 (63%), Positives = 46/60 (76%) Frame = -2 Query: 244 GKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTAN 65 G K+T QC++V GV DTC IT+ F +T EFF++INPNLNCD LFVGQW+CV GTAN Sbjct: 30 GAKKATPQCDTVVGVESGDTCSDITEKFQLTTEFFDSINPNLNCDALFVGQWVCVDGTAN 89 >ref|XP_007025814.1| Uncharacterized protein TCM_030004 [Theobroma cacao] gi|508781180|gb|EOY28436.1| Uncharacterized protein TCM_030004 [Theobroma cacao] Length = 94 Score = 87.0 bits (214), Expect = 2e-15 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -2 Query: 235 KSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTA 68 +S C+ V+GV DTCFG+TQ+FN+T FF+++NPNLNC LFVGQWLC+AG+A Sbjct: 39 QSAPSCDKVYGVASGDTCFGVTQMFNLTTAFFDSVNPNLNCTSLFVGQWLCIAGSA 94 >emb|CAN74549.1| hypothetical protein VITISV_011099 [Vitis vinifera] Length = 92 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -2 Query: 238 AKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTAN 65 AK+T +C++V GV DTCF I F +T EFF++INPNLNCD LFVGQW+CV GTAN Sbjct: 35 AKATPECDTVVGVESGDTCFDIADKFQLTTEFFDSINPNLNCDALFVGQWVCVDGTAN 92 >emb|CAN74548.1| hypothetical protein VITISV_011098 [Vitis vinifera] Length = 89 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/60 (61%), Positives = 44/60 (73%) Frame = -2 Query: 244 GKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTAN 65 G KST +C++V GV DTCF I F +T EFF++INPNLNCD LFVGQW+CV GT N Sbjct: 30 GAKKSTPECDAVVGVESGDTCFDIADKFQLTTEFFDSINPNLNCDALFVGQWVCVDGTVN 89 >ref|XP_006437900.1| hypothetical protein CICLE_v10033348mg [Citrus clementina] gi|557540096|gb|ESR51140.1| hypothetical protein CICLE_v10033348mg [Citrus clementina] Length = 92 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/59 (59%), Positives = 46/59 (77%) Frame = -2 Query: 244 GKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTA 68 G KS C+SV+G ++ DTCF + + FN++ EFF+ INPNLNCD +FVGQWLCVAG+A Sbjct: 34 GAVKSLPTCDSVYGTQEGDTCFDVAKEFNLSTEFFSAINPNLNCDAIFVGQWLCVAGSA 92 >ref|XP_002525615.1| conserved hypothetical protein [Ricinus communis] gi|223535051|gb|EEF36733.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/61 (59%), Positives = 46/61 (75%) Frame = -2 Query: 250 SFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGT 71 S G AKST +C+SV+G + DTC + F++T EFF++INPNLNCD +FVGQWLC GT Sbjct: 36 SSGDAKSTPECDSVYGAQDGDTCTSVATQFDLTLEFFSSINPNLNCDAIFVGQWLCADGT 95 Query: 70 A 68 A Sbjct: 96 A 96 >emb|CAN82208.1| hypothetical protein VITISV_000178 [Vitis vinifera] Length = 89 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -2 Query: 244 GKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTAN 65 G K+T QC++V GV DTC I + F ++ EFF++INPNLNCD LFVGQW+CV GTAN Sbjct: 30 GAKKATPQCDTVVGVESGDTCLDIAEKFQLSTEFFDSINPNLNCDALFVGQWVCVDGTAN 89 >emb|CAN82204.1| hypothetical protein VITISV_000174 [Vitis vinifera] Length = 91 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/60 (60%), Positives = 44/60 (73%) Frame = -2 Query: 244 GKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGTAN 65 G ++T QC++V GV DTCF I +T EFF++INPNLNCD LFVGQW+CV GTAN Sbjct: 32 GAKEATPQCDAVVGVESGDTCFDIADKLQLTTEFFDSINPNLNCDALFVGQWVCVDGTAN 91 >ref|XP_007214205.1| hypothetical protein PRUPE_ppa021979mg [Prunus persica] gi|462410070|gb|EMJ15404.1| hypothetical protein PRUPE_ppa021979mg [Prunus persica] Length = 88 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = -2 Query: 229 TLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGT 71 TL+CESV+GV+ DTCF I Q F++ EFF++INPNLNC LFVGQW+C+ GT Sbjct: 34 TLKCESVYGVKSGDTCFTIAQTFSLPTEFFDSINPNLNCAALFVGQWVCLNGT 86 >ref|XP_002525617.1| conserved hypothetical protein [Ricinus communis] gi|223535053|gb|EEF36735.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -2 Query: 250 SFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGT 71 S G A ST +C+SV+G + DTC I F++T EFF++INPNLNCD +FVGQWLC GT Sbjct: 36 SSGDANSTPECDSVYGAQDGDTCTSIATQFDLTLEFFSSINPNLNCDAIFVGQWLCTDGT 95 >ref|XP_007217675.1| hypothetical protein PRUPE_ppa024427mg [Prunus persica] gi|462413825|gb|EMJ18874.1| hypothetical protein PRUPE_ppa024427mg [Prunus persica] Length = 98 Score = 81.3 bits (199), Expect = 1e-13 Identities = 31/63 (49%), Positives = 45/63 (71%) Frame = -2 Query: 253 VSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAG 74 + FG K C +V+G + DTC ++++FN++ +FF +INPN+NCD FVGQWLC AG Sbjct: 36 IGFGGKKPAAVCAAVYGAEEGDTCTSVSEMFNLSLDFFLSINPNINCDNFFVGQWLCTAG 95 Query: 73 TAN 65 +AN Sbjct: 96 SAN 98 >ref|XP_006432142.1| hypothetical protein CICLE_v10003665mg [Citrus clementina] gi|557534264|gb|ESR45382.1| hypothetical protein CICLE_v10003665mg [Citrus clementina] Length = 91 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/64 (56%), Positives = 48/64 (75%) Frame = -2 Query: 259 FAVSFGKAKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCV 80 FAV KA T C+SV+G ++ DTCF ++Q FN++ E F INPN++CD +FVGQWLCV Sbjct: 30 FAVGLVKAPPT--CDSVYGAQEGDTCFDVSQKFNLSNELFLAINPNIDCDAVFVGQWLCV 87 Query: 79 AGTA 68 AG+A Sbjct: 88 AGSA 91 >ref|XP_002309907.1| hypothetical protein POPTR_0007s04060g [Populus trichocarpa] gi|222852810|gb|EEE90357.1| hypothetical protein POPTR_0007s04060g [Populus trichocarpa] Length = 95 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = -2 Query: 238 AKSTLQCESVFGVRKADTCFGITQVFNMTAEFFNTINPNLNCDKLFVGQWLCVAGT 71 AKST +C+ V G DTCF I Q FN+TA F+ INPNLNC LFVGQWLCVAG+ Sbjct: 39 AKSTPECDEVVGAASGDTCFTIAQSFNLTAASFDAINPNLNCTALFVGQWLCVAGS 94