BLASTX nr result
ID: Cocculus23_contig00049122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049122 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004360475.1| hypothetical protein DFA_04754 [Dictyosteliu... 63 5e-08 >ref|XP_004360475.1| hypothetical protein DFA_04754 [Dictyostelium fasciculatum] gi|328874258|gb|EGG22624.1| hypothetical protein DFA_04754 [Dictyostelium fasciculatum] Length = 50 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 228 MDQAAKDNKSNQQNQNHPSGGGIGSRPAGYTGAASNLDNRSDQLNKN 88 MD+ A+DNKSNQQN NHPS G R +GY+GA SNLDNR++Q+N N Sbjct: 1 MDKQAQDNKSNQQNPNHPSTG--PGRSSGYSGAPSNLDNRANQMNPN 45