BLASTX nr result
ID: Cocculus23_contig00048262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00048262 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia ... 81 1e-13 gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistrom... 79 5e-13 gb|EME88236.1| hypothetical protein MYCFIDRAFT_124602, partial [... 70 2e-10 gb|EMF17076.1| hypothetical protein SEPMUDRAFT_146171 [Sphaeruli... 68 1e-09 ref|XP_003856651.1| hypothetical protein MYCGRDRAFT_54115, parti... 67 2e-09 gb|EMD69302.1| hypothetical protein COCSADRAFT_32047 [Bipolaris ... 65 1e-08 gb|EOA90793.1| hypothetical protein SETTUDRAFT_166685 [Setosphae... 64 2e-08 gb|EMD95960.1| hypothetical protein COCHEDRAFT_1019459 [Bipolari... 64 3e-08 gb|EUC35894.1| hypothetical protein COCCADRAFT_34620 [Bipolaris ... 63 4e-08 gb|EUC50432.1| hypothetical protein COCMIDRAFT_82145 [Bipolaris ... 62 6e-08 gb|EOO01408.1| hypothetical protein UCRPA7_3073 [Togninia minima... 62 1e-07 ref|XP_001797836.1| hypothetical protein SNOG_07502 [Phaeosphaer... 60 4e-07 ref|XP_003305984.1| hypothetical protein PTT_18987 [Pyrenophora ... 59 5e-07 ref|XP_001936376.1| conserved hypothetical protein [Pyrenophora ... 59 5e-07 ref|XP_003836922.1| hypothetical protein LEMA_P044580.1 [Leptosp... 59 7e-07 gb|EXJ94398.1| hypothetical protein A1O1_02792 [Capronia coronat... 58 1e-06 dbj|BAJ95991.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 >gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] Length = 305 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +1 Query: 133 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 MGIVKGGALRL Q+ LYA+EF CAAIILGIYSYFLSVLADR LPI W Sbjct: 1 MGIVKGGALRLLQSGLYAIEFLCAAIILGIYSYFLSVLADRHLPIATW 48 >gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistroma septosporum NZE10] Length = 288 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 133 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPI 267 MGI KGGALRLFQTFLYALEFCCAA+ +G++SYFL+VLADRD I Sbjct: 1 MGIFKGGALRLFQTFLYALEFCCAAVCIGVFSYFLAVLADRDTGI 45 >gb|EME88236.1| hypothetical protein MYCFIDRAFT_124602, partial [Pseudocercospora fijiensis CIRAD86] Length = 277 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 142 VKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 +KGGALRLFQT LYAL F C+A+ LGIYSYFL+VLADRD I W Sbjct: 1 IKGGALRLFQTLLYALAFGCSAVALGIYSYFLAVLADRDAHIPRW 45 >gb|EMF17076.1| hypothetical protein SEPMUDRAFT_146171 [Sphaerulina musiva SO2202] Length = 282 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 133 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 M ++KGG LRLFQTFLY L F CAA+IL IYSYFL+ LADR+ I W Sbjct: 1 MALIKGGFLRLFQTFLYLLAFLCAALILAIYSYFLATLADRNGNIMTW 48 >ref|XP_003856651.1| hypothetical protein MYCGRDRAFT_54115, partial [Zymoseptoria tritici IPO323] gi|339476536|gb|EGP91627.1| hypothetical protein MYCGRDRAFT_54115 [Zymoseptoria tritici IPO323] Length = 283 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = +1 Query: 133 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRD--LPIYE 273 MG++KGG +R+ QTF+Y L F C+A+ LGIY+YFLSVLADRD +P YE Sbjct: 1 MGLIKGGFMRVTQTFIYFLAFLCSAVALGIYAYFLSVLADRDVGIPTYE 49 >gb|EMD69302.1| hypothetical protein COCSADRAFT_32047 [Bipolaris sorokiniana ND90Pr] Length = 288 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T +YALEFCCAAIILGIYSYFLSV ADRD+ I W Sbjct: 5 GAALKFGSTAIYALEFCCAAIILGIYSYFLSVQADRDVNIPVW 47 >gb|EOA90793.1| hypothetical protein SETTUDRAFT_166685 [Setosphaeria turcica Et28A] Length = 288 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T LYALEFCCAAIILGIYSYFL+V ADRD+ I W Sbjct: 5 GAALKFGSTALYALEFCCAAIILGIYSYFLAVQADRDVHIPVW 47 >gb|EMD95960.1| hypothetical protein COCHEDRAFT_1019459 [Bipolaris maydis C5] gi|477593750|gb|ENI10819.1| hypothetical protein COCC4DRAFT_35709 [Bipolaris maydis ATCC 48331] Length = 288 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T +YALEFCCAAIILGIYSYFL+V ADRD+ I W Sbjct: 5 GAALKFGSTAIYALEFCCAAIILGIYSYFLAVQADRDVNIPVW 47 >gb|EUC35894.1| hypothetical protein COCCADRAFT_34620 [Bipolaris zeicola 26-R-13] gi|578493228|gb|EUN30622.1| hypothetical protein COCVIDRAFT_13025 [Bipolaris victoriae FI3] Length = 288 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T +YALEFCCAAI+LGIYSYFL+V ADRD+ I W Sbjct: 5 GAALKFGSTAIYALEFCCAAIVLGIYSYFLAVQADRDVNIPVW 47 >gb|EUC50432.1| hypothetical protein COCMIDRAFT_82145 [Bipolaris oryzae ATCC 44560] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T +Y LEFCCAAIILGIYSYFL+V ADRD+ I W Sbjct: 5 GAALKFGSTAIYTLEFCCAAIILGIYSYFLAVQADRDVNIAVW 47 >gb|EOO01408.1| hypothetical protein UCRPA7_3073 [Togninia minima UCRPA7] Length = 290 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 133 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 MG G AL+LFQ F+ ++FCCAA+IL I+SYFL+ LA+ DL I+ W Sbjct: 1 MGAKSGFALKLFQWFVRGIQFCCAALILAIFSYFLATLANHDLTIHTW 48 >ref|XP_001797836.1| hypothetical protein SNOG_07502 [Phaeosphaeria nodorum SN15] gi|111063848|gb|EAT84968.1| hypothetical protein SNOG_07502 [Phaeosphaeria nodorum SN15] Length = 274 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 142 VKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 V G LR T +YAL FCCA +ILGIYSYFL+V ADRD+ I W Sbjct: 3 VGGVILRFGSTLIYALAFCCAGLILGIYSYFLAVQADRDVTIPRW 47 >ref|XP_003305984.1| hypothetical protein PTT_18987 [Pyrenophora teres f. teres 0-1] gi|311316727|gb|EFQ85909.1| hypothetical protein PTT_18987 [Pyrenophora teres f. teres 0-1] Length = 288 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T LYALEF CAA++LGIYSYFL+V ADRD I W Sbjct: 5 GAALKFGSTALYALEFACAAVVLGIYSYFLAVEADRDARIPTW 47 >ref|XP_001936376.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983475|gb|EDU48963.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 291 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G AL+ T LYALEF CAA++LGIYSYFL+V ADRD I W Sbjct: 5 GAALKFGSTALYALEFACAAVVLGIYSYFLAVEADRDARIPTW 47 >ref|XP_003836922.1| hypothetical protein LEMA_P044580.1 [Leptosphaeria maculans JN3] gi|312213475|emb|CBX93557.1| hypothetical protein LEMA_P044580.1 [Leptosphaeria maculans JN3] Length = 279 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 154 ALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 AL+L T LYA+EF CAAI+LGIYSYFLSV ADR++ I W Sbjct: 7 ALKLGSTALYAIEFACAAIVLGIYSYFLSVQADRNVSIDTW 47 >gb|EXJ94398.1| hypothetical protein A1O1_02792 [Capronia coronata CBS 617.96] Length = 264 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G LR QT L LEFCCAAI+LGIYSYFL+VLADR+ I W Sbjct: 5 GVILRFGQTGLRILEFCCAAIVLGIYSYFLAVLADRNTHIPAW 47 >dbj|BAJ95991.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 257 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +1 Query: 148 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADRDLPIYEW 276 G LR QT L +EFCCAAI+LGIYSYFL+VL+ D+ I W Sbjct: 5 GAFLRFGQTGLRIIEFCCAAIVLGIYSYFLAVLSRHDMTIPTW 47