BLASTX nr result
ID: Cocculus23_contig00047663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00047663 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003856567.1| hypothetical protein MYCGRDRAFT_22102, parti... 61 1e-07 >ref|XP_003856567.1| hypothetical protein MYCGRDRAFT_22102, partial [Zymoseptoria tritici IPO323] gi|339476452|gb|EGP91543.1| hypothetical protein MYCGRDRAFT_22102 [Zymoseptoria tritici IPO323] Length = 587 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +2 Query: 176 IDNPLIRLRPDEVEKKTRQFVRDFGLANQEDVFVKAGKVLRDPAAWQSVAGLT 334 IDNPL+R P E+EK+T++FVR + L QE VF +LRDP AW+SV LT Sbjct: 2 IDNPLLRFSPQEIEKRTKEFVRTYDLLKQEGVF-----ILRDPEAWESVPDLT 49