BLASTX nr result
ID: Cocculus23_contig00047159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00047159 (202 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62636.1| hypothetical protein VITISV_006313 [Vitis vinifera] 49 8e-06 >emb|CAN62636.1| hypothetical protein VITISV_006313 [Vitis vinifera] Length = 1246 Score = 48.5 bits (114), Expect(2) = 8e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 165 KSNPPCLWILDFGATDHMTGSSKSFVTYKNC 73 KSN C WI+D GATDHMTGSS+ F +YK C Sbjct: 238 KSNVHCPWIIDSGATDHMTGSSQIFSSYKPC 268 Score = 26.6 bits (57), Expect(2) = 8e-06 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 83 IKIADCSLSTIAXXXXXXXXXSLTLHN 3 IKIAD SLS IA SLTLHN Sbjct: 274 IKIADGSLSAIAGKGSVFISPSLTLHN 300